Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15093 82 / 3e-20 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T034182 [exp] 129 / 2e-40 AT4G15093 102 / 3e-28 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1) Potri.004G135300 [exp] 119 / 1e-34 AT4G15093 358 / 1e-125 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1) Potri.004G135200 [exp] 94 / 1e-24 AT4G15093 343 / 8e-120 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1) Potri.018G136800 [exp] 94 / 2e-24 AT4G15093 335 / 3e-116 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1) Potri.T045400 [exp] 94 / 2e-24 AT4G15093 338 / 1e-117 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034361 [exp] 91 / 3e-23 AT4G15093 364 / 6e-128 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0283 [poplar] [flax] LigB PF02900 [poplar] [flax] LigB Catalytic LigB subunit of aromatic ring-opening dioxygenase
Representative CDS sequence Show only first row Show all	>Potri.018G145550.1 pacid=42800616 polypeptide=Potri.018G145550.1.p locus=Potri.018G145550 ID=Potri.018G145550.1.v4.1 annot-version=v4.1 ATGGCTTTGATGGAAACATTGTATCTCTCACATGGAGCTCCAACACTTGCTATTGATGAAACCGCACCAACAAGACAATTCTTTAAATCATGGCAACAAA GTGTGTACAAAGAGAAACCGAGTTCCATTCTTGTTATTTCTGCTCACTGGGAGACCGAACCTACTGTTAATGTTGTTGATCGAAATGATACCAGACTTCT ATGGCTTCCCCAAGCCCTTGTACCAGGCTACACCTCTATGCTGAGAAATAATGTTCGTTCACGTGCCTTGGGATCTGAATTGGTTGTGGTTACCGTGCTG AGCGTTGCTGCATCATGA
AA sequence Show only first row Show all	>Potri.018G145550.1 pacid=42800616 polypeptide=Potri.018G145550.1.p locus=Potri.018G145550 ID=Potri.018G145550.1.v4.1 annot-version=v4.1 MALMETLYLSHGAPTLAIDETAPTRQFFKSWQQSVYKEKPSSILVISAHWETEPTVNVVDRNDTRLLWLPQALVPGYTSMLRNNVRSRALGSELVVVTVL SVAAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15093			catalytic LigB subunit of arom...		Potri.018G145550 [exp]	0	1
AT4G10590		UBP10	ubiquitin-specific protease 10...		Potri.016G067400 [exp]	15.77	0.7616
AT5G14850			Alg9-like mannosyltransferase ...		Potri.018G098700 [exp]	36.18	0.6645
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Potri.012G069300 [exp]	39.24	0.7205	ATHVA22.1
AT3G62790			NADH-ubiquinone oxidoreductase...		Potri.002G204800 [exp]	58.20	0.6990
AT3G13410			unknown protein		Potri.003G223601 [exp]	80.99	0.6858
AT4G32940		GAMMAVPE, GAMMA...	gamma vacuolar processing enzy...		Potri.018G059400 [exp]	157.64	0.6476	GAMMA-VPE.1
AT3G50860			Clathrin adaptor complex small...		Potri.005G122900 [exp]	168.24	0.6492
AT1G02970		ATWEE1, WEE1	WEE1 kinase homolog (.1)		Potri.014G132400 [exp]	173.66	0.6523
AT4G35590		RKD5	RWP-RK domain-containing 5, RW...		Potri.005G101000 [exp]	179.58	0.6411
AT3G24110			Calcium-binding EF-hand family...		Potri.017G054902 [exp]	198.39	0.6200

Compare expression of checked genes

Potri.018G145550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.