Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08450 76 / 5e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T044700 [exp] 79 / 6e-19 AT5G08450 796 / 0.0 unknown protein Potri.004G135800 [exp] 76 / 3e-18 AT5G08450 860 / 0.0 unknown protein Potri.018G145560 [exp] 76 / 4e-18 AT5G08450 801 / 0.0 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019217 [exp] 77 / 3e-18 AT5G08450 858 / 0.0 unknown protein Lus10004299 [exp] 77 / 3e-18 AT5G08450 852 / 0.0 unknown protein Lus10004298 [exp] 42 / 2e-06 AT5G08450 130 / 5e-36 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G145552.1 pacid=42800909 polypeptide=Potri.018G145552.1.p locus=Potri.018G145552 ID=Potri.018G145552.1.v4.1 annot-version=v4.1 ATGATTAATGTTTCAATTTTGATGCCTGCATATATCAGGATAAAATACAGCATTAGTATTGTTGCTGACAAGGGTCTGAAAAAGCCTCTCTATACTTCAG AACGTTTGAAGAAGGGGGAAGTTCTGTATTTAGAAACACATTCATGCAGGAGAGAAAATGGGAAAGTGACACAGGCTTCTCACTCAGGTGCATGA
AA sequence Show only first row Show all	>Potri.018G145552.1 pacid=42800909 polypeptide=Potri.018G145552.1.p locus=Potri.018G145552 ID=Potri.018G145552.1.v4.1 annot-version=v4.1 MINVSILMPAYIRIKYSISIVADKGLKKPLYTSERLKKGEVLYLETHSCRRENGKVTQASHSGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G08450			unknown protein		Potri.018G145552 [exp]	0	1
					Potri.010G155701 [exp]	2.44	0.8912
					Potri.017G047000 [exp]	4.00	0.8812
					Potri.017G065250 [exp]	12.48	0.8440
AT2G20000		CDC27b, HBT	HOBBIT, CDC27 family protein ...		Potri.006G164000 [exp]	17.66	0.7974
AT5G15150	HD	ATHB3, HAT7, AT...	HOMEOBOX FROM ARABIDOPSIS THAL...		Potri.008G194400 [exp]	19.89	0.7789
AT3G01930			Major facilitator superfamily ...		Potri.017G064201 [exp]	27.92	0.8113
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.016G120466 [exp]	29.94	0.8383
AT3G16690		SWEET16, AtSWEE...	Nodulin MtN3 family protein (....		Potri.005G023900 [exp]	30.85	0.7628
					Potri.002G001250 [exp]	42.70	0.7624
AT1G16260			Wall-associated kinase family ...		Potri.009G157201 [exp]	43.31	0.8310

Compare expression of checked genes

Potri.018G145552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.