Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36760 84 / 4e-21 ATAPP1 ARABIDOPSIS THALIANA AMINOPEPTIDASE P1, aminopeptidase P1 (.1) AT3G05350 68 / 2e-15 Metallopeptidase M24 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G029700 [exp] 97 / 9e-26 AT4G36760 1015 / 0.0 ARABIDOPSIS THALIANA AMINOPEPTIDASE P1, aminopeptidase P1 (.1) Potri.007G030050 [exp] 94 / 9e-26 AT4G36760 397 / 4e-136 ARABIDOPSIS THALIANA AMINOPEPTIDASE P1, aminopeptidase P1 (.1) Potri.013G021400 [exp] 69 / 1e-15 AT3G05350 1025 / 0.0 Metallopeptidase M24 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024034 [exp] 84 / 6e-21 AT4G36760 924 / 0.0 ARABIDOPSIS THALIANA AMINOPEPTIDASE P1, aminopeptidase P1 (.1) Lus10041716 [exp] 84 / 7e-21 AT4G36760 987 / 0.0 ARABIDOPSIS THALIANA AMINOPEPTIDASE P1, aminopeptidase P1 (.1) Lus10029923 [exp] 69 / 1e-15 AT3G05350 978 / 0.0 Metallopeptidase M24 family protein (.1) Lus10004479 [exp] 68 / 3e-15 AT3G05350 910 / 0.0 Metallopeptidase M24 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00557 [poplar] [flax] Peptidase_M24 Metallopeptidase family M24
Representative CDS sequence Show only first row Show all	>Potri.018G145584.1 pacid=42801957 polypeptide=Potri.018G145584.1.p locus=Potri.018G145584 ID=Potri.018G145584.1.v4.1 annot-version=v4.1 ATGCTTGTTTTCTCAACTGAACTAATGATCATGCCCTTGACATTCTTTGCTCGAATTCCTTTATGGAAGGATGGTCTTGATTATCGACATGGCACTGGTC ATGGTATTGGATCATACCTAAATGTACATGAAGGACCTCATTTAATTAGTTTCAGACCACATGCTCGTAATTAG
AA sequence Show only first row Show all	>Potri.018G145584.1 pacid=42801957 polypeptide=Potri.018G145584.1.p locus=Potri.018G145584 ID=Potri.018G145584.1.v4.1 annot-version=v4.1 MLVFSTELMIMPLTFFARIPLWKDGLDYRHGTGHGIGSYLNVHEGPHLISFRPHARN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36760		ATAPP1	ARABIDOPSIS THALIANA AMINOPEPT...		Potri.018G145584 [exp]	0	1
AT1G72770		HAB1	HYPERSENSITIVE TO ABA1, homolo...		Potri.001G198400 [exp]	5.29	0.8313
AT5G11970			Protein of unknown function (D...		Potri.006G225900 [exp]	13.67	0.7819
AT4G36760		ATAPP1	ARABIDOPSIS THALIANA AMINOPEPT...		Potri.018G145576 [exp]	28.24	0.7708
AT3G61920			unknown protein		Potri.002G178900 [exp]	30.39	0.7625
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Potri.004G079100 [exp]	37.22	0.7523
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.014G167550 [exp]	43.81	0.7861
AT5G07610			F-box family protein (.1)		Potri.001G146000 [exp]	49.19	0.7671
AT3G48880			RNI-like superfamily protein (...		Potri.016G019500 [exp]	59.59	0.7175
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.008G052100 [exp]	63.46	0.7556
AT5G43420			RING/U-box superfamily protein...		Potri.002G039700 [exp]	66.63	0.7425

Compare expression of checked genes

Potri.018G145584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.