Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PBA1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31300 404 / 4e-145 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 100 / 5e-25 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 98 / 2e-24 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G13060 87 / 3e-20 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 79 / 2e-17 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT4G14800 53 / 1e-08 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G22630 52 / 5e-08 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT3G22110 47 / 3e-06 PAC1 20S proteasome alpha subunit C1 (.1) AT1G53850 45 / 9e-06 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G14290 45 / 9e-06 PAE2 20S proteasome alpha subunit E2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G077900 [exp] 441 / 1e-159 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 99 / 1e-24 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.004G066000 [exp] 97 / 4e-24 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G177000 [exp] 80 / 8e-18 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.010G058100 [exp] 80 / 1e-17 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.016G015400 [exp] 48 / 1e-06 AT3G22110 445 / 1e-160 20S proteasome alpha subunit C1 (.1) Potri.006G008800 [exp] 47 / 4e-06 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020180 [exp] 406 / 1e-145 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 333 / 7e-115 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10014581 [exp] 105 / 7e-27 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10032102 [exp] 103 / 1e-26 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10006426 [exp] 78 / 7e-17 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 78 / 7e-17 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10041194 [exp] 56 / 2e-09 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10039351 [exp] 54 / 8e-09 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10042145 [exp] 46 / 6e-06 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.018G145900.1 pacid=42802105 polypeptide=Potri.018G145900.1.p locus=Potri.018G145900 ID=Potri.018G145900.1.v4.1 annot-version=v4.1 ATGGAATCACACAAAGAAAATGAGATCAACGGCCCTCATTCCATGGGGACAACCATCATCGGCGTCACCTACAACGGCGGTGTCGTCCTCGGTGCCGATT CTCGCACCAGCACCGGAGTTTATGTTGCAAATCGAGCATCAGATAAAATCACTCAGCTTACTGATAATGTCTACTTATGCCGCTCTGGATCTGCTGCTGA TTCTCAAACTGTGTCTGATTATGTGAGATATTTTCTGCATCAACACACAATACAATTGGGGCAGCCTGCGACAGTTAAGGTTGCTGCTAATCTTGTTAGG ATGTTGTCTTACAATAACAAGAATTTCTTGCAAACTGGAATGATTGTTGGGGGTTGGGATAAGTATGAAGGAGGTAAAATTTATGGAGTACCTCTTGGAG GGACACTTTTGGAGCTGCCTTTTACAATTGGAGGATCAGGATCTTCTTACTTGTATGGTTTCTTTGATCAAGCATGGAAGGATGGGATGACTCAAGAAGA AGCTGAGCAATTAGTGGTGAAAGCAGTTTCTCTTGCTATTGCTCGTGATGGTGCGAGTGGTGGTGTTGTTCGGACTGTCACTATCAACTCAGAAGGCGTG TCAAGAAAGTACTACCCTGAGGACAAGCTCCCACGATGGCACGAGGAGCTGGAGCCACAGAATTCCCTGTTGGACATTTTGTCATCATCGAGTCCTGAGC CAATGGTCACTTAA
AA sequence Show only first row Show all	>Potri.018G145900.1 pacid=42802105 polypeptide=Potri.018G145900.1.p locus=Potri.018G145900 ID=Potri.018G145900.1.v4.1 annot-version=v4.1 MESHKENEINGPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVR MLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTLLELPFTIGGSGSSYLYGFFDQAWKDGMTQEEAEQLVVKAVSLAIARDGASGGVVRTVTINSEGV SRKYYPEDKLPRWHEELEPQNSLLDILSSSSPEPMVT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G31300		PBA1	N-terminal nucleophile aminohy...		Potri.018G145900 [exp]	0	1	Pt-PBA1.1
AT4G30010			unknown protein		Potri.018G142500 [exp]	1.00	0.9177
AT2G30942			Protein of unknown function (D...		Potri.001G000400 [exp]	3.16	0.8373
AT1G67250			Proteasome maturation factor U...		Potri.017G111900 [exp]	4.69	0.8521
AT5G28050			Cytidine/deoxycytidylate deami...		Potri.010G003500 [exp]	6.00	0.8353
AT5G55290			ATPase, V0 complex, subunit E ...		Potri.011G092600 [exp]	6.00	0.8480
AT5G66140		PAD2	proteasome alpha subunit D2 (....		Potri.009G133800 [exp]	10.00	0.8268	Pt-PAD1.3
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.008G189900 [exp]	10.09	0.8097
AT1G25520			Uncharacterized protein family...		Potri.010G128400 [exp]	10.48	0.7247
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Potri.015G140400 [exp]	13.41	0.8054
AT2G01470		ATSEC12, STL2P	SEC12P-like 2 protein (.1)		Potri.008G130300 [exp]	14.28	0.7747

Compare expression of checked genes

Potri.018G145900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.