Potri.018G146200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G114375 64 / 2e-14 AT5G09520 / Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G146200.1 pacid=42800618 polypeptide=Potri.018G146200.1.p locus=Potri.018G146200 ID=Potri.018G146200.1.v4.1 annot-version=v4.1
ATGGCTTCTCTTCGTTTCCTGACATTTATTTCACCACTCTTGCTGATCACTTTGTCATTGGTGGACAACACAAGCAGGATAGAAGCGCGCAGGATTTTGG
AGACAACATTGCCTAAGGTTCCTGAGCTCCCTAAGCCTGAATTGCCTGAGCTGCCACAATTGCCTAAGGTTGAACTTCCACCATTACCGAAACCTGAATT
TCCTGAGCTGCAAAAGCCTGAAGTTCCCAAATTGCCTGAATTACCACCTTTCCCCCATTTACCCGAGCTTCCAAAGTCCACATTACCTACCATACCAGCT
CTTCCCAAGGACATCAAGCCACCTCAGTCTACTACTAGTCCTTAA
AA sequence
>Potri.018G146200.1 pacid=42800618 polypeptide=Potri.018G146200.1.p locus=Potri.018G146200 ID=Potri.018G146200.1.v4.1 annot-version=v4.1
MASLRFLTFISPLLLITLSLVDNTSRIEARRILETTLPKVPELPKPELPELPQLPKVELPPLPKPEFPELQKPEVPKLPELPPFPHLPELPKSTLPTIPA
LPKDIKPPQSTTSP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G09520 PELPK2 Pro-Glu-Leu|Ile|Val-Pro-Lys 2,... Potri.018G146200 0 1
AT4G03540 Uncharacterised protein family... Potri.011G052100 1.00 0.9346
AT5G65090 DER4, MRH3, BST... DEFORMED ROOT HAIRS 4, BRISTLE... Potri.005G078000 3.74 0.7961
AT3G63240 DNAse I-like superfamily prote... Potri.005G212700 3.74 0.8753
AT5G44440 FAD-binding Berberine family p... Potri.011G157900 4.69 0.7722
AT3G22060 Receptor-like protein kinase-r... Potri.017G040215 6.78 0.7719
Potri.012G115400 7.74 0.8095
AT1G06520 ATGPAT1, GPAT1 glycerol-3-phosphate acyltrans... Potri.005G202200 7.74 0.8465
AT1G72490 unknown protein Potri.003G068300 8.00 0.7492
AT3G61220 SDR1 short-chain dehydrogenase/redu... Potri.002G156300 8.36 0.8409
AT1G49480 B3 REM19, RTV1 related to vernalization1 1 (.... Potri.004G147200 8.94 0.7766

Potri.018G146200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.