Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41685 77 / 1e-20 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) AT1G64220 72 / 1e-18 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G145502 [exp] 108 / 5e-33 AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.006G077500 [exp] 107 / 1e-32 AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001641 [exp] 88 / 7e-25 AT5G41685 85 / 1e-23 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10000059 [exp] 81 / 5e-22 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10016473 [exp] 81 / 5e-22 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10007843 [exp] 81 / 5e-22 AT5G41685 85 / 5e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10004754 [exp] 81 / 6e-22 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10040758 [exp] 81 / 7e-22 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08038 [poplar] [flax] Tom7 TOM7 family
Representative CDS sequence Show only first row Show all	>Potri.018G146602.1 pacid=42800804 polypeptide=Potri.018G146602.1.p locus=Potri.018G146602 ID=Potri.018G146602.1.v4.1 annot-version=v4.1 ATGGCGTCTAGGGTTTCTCTAAAGACGAAAGGCAAGAGCAGCAGCGGCAAGGGAGCAAAAGGTGTGGAAGAGAAGTCAGCATCACAGTATGTCAAAGAAT GGAGCACATGGACATTTAAGAAGGCGAAAGTAATCACACACTATGGATTCATTCCTATGATTATCATCATTGGAATGAATTCTGAGCCTAAACCCCAGAT TTATCAGCTCCTTAGTCCCTTCTGA
AA sequence Show only first row Show all	>Potri.018G146602.1 pacid=42800804 polypeptide=Potri.018G146602.1.p locus=Potri.018G146602 ID=Potri.018G146602.1.v4.1 annot-version=v4.1 MASRVSLKTKGKSSSGKGAKGVEEKSASQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMNSEPKPQIYQLLSPF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41685			Mitochondrial outer membrane t...		Potri.018G146602 [exp]	0	1
AT5G10200			ARM-repeat/Tetratricopeptide r...		Potri.005G076300 [exp]	3.00	0.7452
AT5G41685			Mitochondrial outer membrane t...		Potri.018G145502 [exp]	4.24	0.7711
AT1G48560			unknown protein		Potri.003G188600 [exp]	12.84	0.7394
AT5G45600		TAF14b, GAS41	TBP-ASSOCIATED FACTOR 14B, GLI...		Potri.007G012700 [exp]	15.03	0.7738
AT2G33840			Tyrosyl-tRNA synthetase, class...		Potri.008G010201 [exp]	16.24	0.7225
AT5G15640			Mitochondrial substrate carrie...		Potri.008G100100 [exp]	17.54	0.7306
AT2G16390		DMS1, CHR35, DR...	DEFECTIVE IN RNA-DIRECTED DNA ...		Potri.004G159000 [exp]	22.13	0.7553
AT5G47540			Mo25 family protein (.1)		Potri.016G011300 [exp]	25.92	0.7589
AT2G39750			S-adenosyl-L-methionine-depend...		Potri.008G059500 [exp]	36.46	0.7436
AT2G19520		ATMSI4, ACG1, N...	MULTICOPY SUPPRESSOR OF IRA1 4...		Potri.003G038800 [exp]	37.30	0.7491	Pt-ATMSI4.2,NFC907

Compare expression of checked genes

Potri.018G146602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.