Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12000 62 / 5e-13 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G24370 54 / 4e-10 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G26150 50 / 5e-09 protein kinase family protein (.1) AT4G31230 50 / 1e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G16760 49 / 2e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G78940 49 / 2e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) AT2G07020 47 / 7e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G35380 47 / 1e-07 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G72760 40 / 3e-05 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G078500 [exp] 75 / 2e-17 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G002400 [exp] 56 / 1e-10 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.007G001900 [exp] 45 / 6e-07 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.018G061600 [exp] 44 / 1e-06 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.004G170943 [exp] 43 / 2e-06 AT1G78940 208 / 1e-63 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.004G170742 [exp] 43 / 3e-06 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.014G001700 [exp] 42 / 7e-06 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.006G225300 [exp] 41 / 1e-05 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.001G198300 [exp] 40 / 3e-05 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008542 [exp] 52 / 2e-09 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 51 / 4e-09 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10040573 [exp] 51 / 4e-09 AT2G24370 815 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10024212 [exp] 47 / 2e-07 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008610 [exp] 44 / 4e-07 AT2G24370 166 / 2e-49 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026989 [exp] 45 / 6e-07 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10020185 [exp] 45 / 7e-07 AT2G24370 741 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10042205 [exp] 44 / 2e-06 AT1G16760 691 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027593 [exp] 42 / 6e-06 AT2G24370 665 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10035712 [exp] 39 / 7e-05 AT1G16760 624 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G146966.1 pacid=42801728 polypeptide=Potri.018G146966.1.p locus=Potri.018G146966 ID=Potri.018G146966.1.v4.1 annot-version=v4.1 ATGATGCTAGGCATGTTTTCTTCAGCAAGTTCTCTCAATCTTTTAAGCTCAGGTAGCATGACTGATCCAAGATCTGGTCTGTCTTCTTGCCTCAGTTCTG CACATCGAAGAGCTAACTTGGTGAATTTCATGGCTTCCTTGATGGGCCAGTCTGGAACGTCTGGGTCAAGCATCTCTGCAAAAGTTCCTGTCTCAATGGC CCTCTCAACATGA
AA sequence Show only first row Show all	>Potri.018G146966.1 pacid=42801728 polypeptide=Potri.018G146966.1.p locus=Potri.018G146966 ID=Potri.018G146966.1.v4.1 annot-version=v4.1 MMLGMFSSASSLNLLSSGSMTDPRSGLSSCLSSAHRRANLVNFMASLMGQSGTSGSSISAKVPVSMALST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G12000			Protein kinase protein with ad...		Potri.018G146966 [exp]	0	1
AT3G13690			Protein kinase protein with ad...		Potri.014G038300 [exp]	3.00	0.7287
AT2G42490			Copper amine oxidase family pr...		Potri.010G045600 [exp]	16.24	0.6486
AT5G66240			Transducin/WD40 repeat-like su...		Potri.005G114600 [exp]	18.73	0.6472
AT1G49180			protein kinase family protein ...		Potri.019G007200 [exp]	21.84	0.6736
AT5G03960		IQD12	IQ-domain 12 (.1)		Potri.006G046000 [exp]	22.22	0.6140
AT1G55150			DEA(D/H)-box RNA helicase fami...		Potri.019G130900 [exp]	26.07	0.6164	Pt-P68.1
AT3G13170		ATSPO11-1	Spo11/DNA topoisomerase VI, su...		Potri.001G366700 [exp]	29.39	0.6409
AT1G57600			MBOAT (membrane bound O-acyl t...		Potri.013G000600 [exp]	33.76	0.6213
AT1G49180			protein kinase family protein ...		Potri.019G011300 [exp]	47.62	0.6342
					Potri.015G116300 [exp]	57.66	0.6373

Compare expression of checked genes

Potri.018G146966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.