Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G07020 47 / 6e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G24370 43 / 2e-06 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G35380 41 / 8e-06 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT4G31230 40 / 2e-05 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G16760 37 / 0.0001 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G20200 36 / 0.0003 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G12000 36 / 0.0004 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G78940 35 / 0.0006 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G078500 [exp] 54 / 1e-10 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.004G170901 [exp] 47 / 6e-08 AT1G78940 584 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.004G170742 [exp] 47 / 6e-08 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.014G001700 [exp] 47 / 6e-08 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.018G002400 [exp] 46 / 8e-08 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.007G001900 [exp] 46 / 1e-07 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.018G061600 [exp] 35 / 0.001 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008542 [exp] 46 / 1e-07 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10040573 [exp] 46 / 1e-07 AT2G24370 815 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10024212 [exp] 45 / 2e-07 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027592 [exp] 45 / 2e-07 AT3G20200 175 / 2e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10009896 [exp] 45 / 2e-07 AT2G24370 632 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10042205 [exp] 45 / 2e-07 AT1G16760 691 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 45 / 3e-07 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10020184 [exp] 43 / 1e-06 AT2G24370 286 / 2e-91 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026989 [exp] 43 / 1e-06 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008609 [exp] 39 / 4e-05 AT1G16760 417 / 3e-137 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G147032.1 pacid=42800939 polypeptide=Potri.018G147032.1.p locus=Potri.018G147032 ID=Potri.018G147032.1.v4.1 annot-version=v4.1 ATGGCCAGAAGGAATGGAGAAAAGAAAGAAGGTGATCAGTACGATGCTTATAATTGGCCAGGTGGAAACAAATTTGACAGCCAAGCCAAAGAGTTGTTCC TTCCATTCCGTTGCTTCTGCAAAAGAAAGGAGATAAAATGCAACGAGGTTGCTCAATAG
AA sequence Show only first row Show all	>Potri.018G147032.1 pacid=42800939 polypeptide=Potri.018G147032.1.p locus=Potri.018G147032 ID=Potri.018G147032.1.v4.1 annot-version=v4.1 MARRNGEKKEGDQYDAYNWPGGNKFDSQAKELFLPFRCFCKRKEIKCNEVAQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G07020			Protein kinase protein with ad...		Potri.018G147032 [exp]	0	1
AT5G51950			Glucose-methanol-choline (GMC)...		Potri.012G135200 [exp]	6.78	0.5704
AT1G77780			Glycosyl hydrolase superfamily...		Potri.002G089200 [exp]	11.70	0.5764
AT1G73930			unknown protein		Potri.001G289250 [exp]	14.96	0.4907
					Potri.006G254450 [exp]	16.00	0.4907
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117034 [exp]	17.88	0.4907
AT5G57810		TET15	tetraspanin15 (.1)		Potri.018G100000 [exp]	19.59	0.4907
					Potri.003G198150 [exp]	81.24	0.3755
AT3G19640		MRS2-3, MGT4	magnesium transporter 4 (.1)		Potri.009G086300 [exp]	147.98	0.3611
AT5G56360		PSL4	PRIORITY IN SWEET LIFE 4, calm...		Potri.013G060332 [exp]	211.06	0.3003
AT1G74000		SS3	strictosidine synthase 3 (.1)		Potri.015G037700 [exp]	232.31	0.3157

Compare expression of checked genes

Potri.018G147032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.