Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34400 96 / 9e-24 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G30700 57 / 3e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18520 54 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G42920 54 / 4e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G38010 53 / 5e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G16860 52 / 2e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G48910 50 / 4e-08 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G04370 50 / 5e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G59200 49 / 2e-07 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G08070 49 / 2e-07 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G144401 [exp] 207 / 2e-70 AT2G34400 164 / 9e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G064301 [exp] 204 / 2e-69 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145514 [exp] 210 / 3e-67 AT2G34400 472 / 4e-162 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.012G108000 [exp] 198 / 3e-61 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041501 [exp] 187 / 1e-60 AT2G34400 251 / 1e-79 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145510 [exp] 192 / 2e-60 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041650 [exp] 186 / 2e-60 AT2G34400 226 / 6e-70 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G144960 [exp] 157 / 5e-51 AT2G34400 122 / 7e-34 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G063709 [exp] 115 / 2e-34 AT2G34400 112 / 3e-30 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010320 [exp] 124 / 5e-34 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10035815 [exp] 62 / 5e-12 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10037387 [exp] 58 / 1e-10 AT3G56550 700 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017446 [exp] 57 / 3e-10 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10041326 [exp] 56 / 8e-10 AT3G56550 702 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10010909 [exp] 55 / 1e-09 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013341 [exp] 54 / 4e-09 AT1G05750 525 / 0.0 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027311 [exp] 52 / 2e-08 AT1G33350 621 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033026 [exp] 51 / 4e-08 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007806 [exp] 50 / 5e-08 AT3G03580 967 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G147873.1 pacid=42800643 polypeptide=Potri.018G147873.1.p locus=Potri.018G147873 ID=Potri.018G147873.1.v4.1 annot-version=v4.1 ATGGCATTCCAAGTGACAACATCCTTGTTTGGCATTGAATCAAAGACCCTCCTCGCAGATATCAAATCCCCACACTTACCATACATGTCAATCAAGGCAG ACCCCACATACGAATTTACCTCCATCTTCTTCTCCAAAACAAGCCCCTCCACCCATCTCCCCAAACCCAAATCCCCACACGCCCCAAGAACATTCACCAG CGTCATCTCATCTGGCTCAAACCCCTCCTCCCTCATTTCCATAAACAACCAAATTGCCTCTTTAGCAAAACCCATCTTAGAATACCCCGAAATCATCGAA TTCCACGACACCAAGTCTCTGTCACCCATTTCATCAAACACCTTCCGTGCAAACCCCATTTCACCACACCTTGCGTCCATTGTAGTCAAAGAATGA
AA sequence Show only first row Show all	>Potri.018G147873.1 pacid=42800643 polypeptide=Potri.018G147873.1.p locus=Potri.018G147873 ID=Potri.018G147873.1.v4.1 annot-version=v4.1 MAFQVTTSLFGIESKTLLADIKSPHLPYMSIKADPTYEFTSIFFSKTSPSTHLPKPKSPHAPRTFTSVISSGSNPSSLISINNQIASLAKPILEYPEIIE FHDTKSLSPISSNTFRANPISPHLASIVVKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.018G147873 [exp]	0	1
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.018G144960 [exp]	3.46	0.7215
AT1G30880			unknown protein		Potri.003G155400 [exp]	19.97	0.7061
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Potri.011G033300 [exp]	23.93	0.7478
AT2G31270		ATCDT1A, CDT1A,...	ARABIDOPSIS HOMOLOG OF YEAST C...		Potri.002G040100 [exp]	28.56	0.6546
AT1G70000	MYB		myb-like transcription factor ...		Potri.008G191800 [exp]	32.55	0.7245
AT4G25210	GeBP		DNA-binding storekeeper protei...		Potri.009G088400 [exp]	43.93	0.6979
AT1G59970			Matrixin family protein (.1)		Potri.019G073700 [exp]	49.11	0.6647
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.019G018000 [exp]	53.40	0.6447
AT5G07900			Mitochondrial transcription te...		Potri.001G030300 [exp]	59.97	0.6211
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.002G031900 [exp]	63.46	0.6828	GBF5.2

Compare expression of checked genes

Potri.018G147873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.