Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01490 67 / 8e-15 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G26690 58 / 6e-12 Heavy metal transport/detoxification superfamily protein (.1) AT3G05220 61 / 9e-12 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G05920 57 / 1e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G37860 57 / 6e-11 Heavy metal transport/detoxification superfamily protein (.1) AT3G06130 57 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G19090 54 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT1G56210 49 / 6e-08 Heavy metal transport/detoxification superfamily protein (.1) AT1G23000 49 / 6e-08 Heavy metal transport/detoxification superfamily protein (.1) AT5G27690 48 / 2e-07 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G079400 [exp] 138 / 9e-44 AT5G37860 66 / 4e-14 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G021200 [exp] 84 / 4e-22 AT3G05220 65 / 6e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G230300 [exp] 74 / 4e-18 AT1G01490 57 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G120200 [exp] 67 / 2e-15 AT3G05220 64 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G032800 [exp] 67 / 3e-15 AT3G05920 52 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G099500 [exp] 61 / 7e-13 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G163400 [exp] 61 / 1e-12 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 61 / 2e-12 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073000 [exp] 58 / 9e-12 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014967 [exp] 65 / 5e-14 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028331 [exp] 65 / 8e-14 AT1G06330 56 / 7e-10 Heavy metal transport/detoxification superfamily protein (.1) Lus10036395 [exp] 65 / 9e-14 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 62 / 7e-13 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 63 / 1e-12 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 58 / 6e-11 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10041228 [exp] 57 / 1e-10 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028762 [exp] 53 / 1e-09 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027523 [exp] 52 / 2e-09 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027522 [exp] 52 / 3e-09 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.018G148900.1 pacid=42800875 polypeptide=Potri.018G148900.1.p locus=Potri.018G148900 ID=Potri.018G148900.1.v4.1 annot-version=v4.1 ATGAAGAAAACAGTGCTAAAAGTCAATATCAATTGCATGAAATGCCAGACGGAGGTGCTGAAAACCGCTGCCAAGCTTGAAGGCATTGATGAGATAGCAG TTGATATTGCGAAGGGAACACTAACAGTAATTGGAGTTGTAGACCCAGTGCTGGTGGCTAAAAAACTCAGAAAATCTGGAAAAATGGTAGAAGTCGTTAG TGTTGGGCCGCCTAAGAAAGAGCCAGACGAAGAAAAAGTAGATTATATAACAGTTGGCTTCCCTAGTTGTTGCAAGGAATGTGAGCTTGTTGCCTTTGGC TTTCCCCCCCATTATCAGGCTCAGATTTGCTCCATTCTTTGA
AA sequence Show only first row Show all	>Potri.018G148900.1 pacid=42800875 polypeptide=Potri.018G148900.1.p locus=Potri.018G148900 ID=Potri.018G148900.1.v4.1 annot-version=v4.1 MKKTVLKVNINCMKCQTEVLKTAAKLEGIDEIAVDIAKGTLTVIGVVDPVLVAKKLRKSGKMVEVVSVGPPKKEPDEEKVDYITVGFPSCCKECELVAFG FPPHYQAQICSIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01490			Heavy metal transport/detoxifi...		Potri.018G148900 [exp]	0	1
AT5G05800			unknown protein		Potri.008G189300 [exp]	7.34	0.6351
AT1G68840	AP2_ERF	EDF2, RAV2, RAP...	TEMPRANILLO 2, RELATED TO AP2 ...		Potri.014G068000 [exp]	12.00	0.6710
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Potri.006G137100 [exp]	12.64	0.6767
AT1G65790		ARK1	receptor kinase 1 (.1)		Potri.004G024316 [exp]	12.96	0.6927
					Potri.012G129400 [exp]	15.58	0.6562
					Potri.006G031300 [exp]	16.58	0.6482
AT1G51400			Photosystem II 5 kD protein (....		Potri.009G052500 [exp]	19.00	0.6340
AT3G57770			Protein kinase superfamily pro...		Potri.005G106600 [exp]	20.39	0.6439
AT5G11950		LOG8	LONELY GUY 8, Putative lysine ...		Potri.003G219300 [exp]	24.37	0.6050
AT2G29260			NAD(P)-binding Rossmann-fold s...		Potri.008G107001 [exp]	29.59	0.4765

Compare expression of checked genes

Potri.018G148900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.