Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49400 150 / 1e-48 EMB1129 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) AT3G18880 150 / 2e-48 Nucleic acid-binding, OB-fold-like protein (.1) AT1G79850 60 / 1e-12 PDE347, CS17, PRPS17, ORE4, RPS17 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) AT4G30800 40 / 4e-05 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G080200 [exp] 192 / 4e-65 AT3G18880 155 / 1e-50 Nucleic acid-binding, OB-fold-like protein (.1) Potri.001G184000 [exp] 47 / 1e-07 AT1G79850 139 / 1e-42 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017993 [exp] 167 / 2e-55 AT3G18880 159 / 3e-52 Nucleic acid-binding, OB-fold-like protein (.1) Lus10017467 [exp] 157 / 2e-51 AT3G18880 154 / 2e-50 Nucleic acid-binding, OB-fold-like protein (.1) Lus10028815 [exp] 146 / 4e-47 AT3G18880 154 / 4e-50 Nucleic acid-binding, OB-fold-like protein (.1) Lus10025799 [exp] 52 / 1e-09 AT1G79850 133 / 9e-41 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) Lus10035863 [exp] 52 / 1e-09 AT1G79850 131 / 6e-40 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [poplar] [flax] OB PF00366 [poplar] [flax] Ribosomal_S17 Ribosomal protein S17
Representative CDS sequence Show only first row Show all	>Potri.018G150100.4 pacid=42801199 polypeptide=Potri.018G150100.4.p locus=Potri.018G150100 ID=Potri.018G150100.4.v4.1 annot-version=v4.1 ATGAAGTCGGTGGTGGGAATGGTGGTGTCGAACAAGATGCAGAAGTCGGTGGTGGTGGCGGTGGACAGGCTGTTCCACCACAAGCTCTACAATCGATACG TCAAGCGGACCTCCAAGTTCATGGCTCACGACGAAAACGACCTCTGCAACATCGGCGATCGAGTTAGATTGGATCCGTCGAGGCCGTTAAGTAAACGGAA GCATTGGGTTGTTGCTGAAATTCTCAAGAAAGCAAGGATATATGTGCCTCCATCAGCAGGGGATAGCGGTGCTCCGAATACTGCTGGGATGAAAGCGTCG GCTTCTTCGACCTCCTAA
AA sequence Show only first row Show all	>Potri.018G150100.4 pacid=42801199 polypeptide=Potri.018G150100.4.p locus=Potri.018G150100 ID=Potri.018G150100.4.v4.1 annot-version=v4.1 MKSVVGMVVSNKMQKSVVVAVDRLFHHKLYNRYVKRTSKFMAHDENDLCNIGDRVRLDPSRPLSKRKHWVVAEILKKARIYVPPSAGDSGAPNTAGMKAS ASSTS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G49400		EMB1129	embryo defective 1129, Nucleic...		Potri.018G150100 [exp]	0	1
AT1G07400			HSP20-like chaperones superfam...		Potri.006G073500 [exp]	2.44	0.8095
AT1G55310		ATSCL33, SR33, ...	SC35-like splicing factor 33 (...		Potri.006G197000 [exp]	3.74	0.7795
AT2G14285			Small nuclear ribonucleoprotei...		Potri.006G167000 [exp]	10.00	0.7031
AT4G27130			Translation initiation factor ...		Potri.011G134700 [exp]	10.67	0.7765
AT4G30820			cyclin-dependent kinase-activa...		Potri.018G103200 [exp]	10.95	0.7117
AT3G53340	CCAAT	NF-YB10	"nuclear factor Y, subunit B10...		Potri.016G085000 [exp]	12.40	0.7445
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Potri.016G138900 [exp]	12.96	0.7440
AT5G06240		EMB2735	embryo defective 2735 (.1)		Potri.016G074700 [exp]	14.49	0.7656
AT1G51200			A20/AN1-like zinc finger famil...		Potri.001G018600 [exp]	15.00	0.7253
AT2G04410			RPM1-interacting protein 4 (RI...		Potri.014G168900 [exp]	15.09	0.7621

Compare expression of checked genes

Potri.018G150100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.