Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06330 74 / 1e-17 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 67 / 4e-15 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 62 / 3e-13 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 61 / 8e-13 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 60 / 2e-12 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 59 / 3e-12 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G56210 60 / 1e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G27690 58 / 7e-11 Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 56 / 9e-11 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G065600 [exp] 72 / 5e-17 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 71 / 1e-16 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G106500 [exp] 67 / 4e-15 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 66 / 8e-15 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G056800 [exp] 66 / 1e-14 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G452400 [exp] 66 / 2e-14 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 62 / 6e-13 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 61 / 8e-13 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.007G087300 [exp] 60 / 2e-12 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013911 [exp] 73 / 5e-17 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10001892 [exp] 67 / 8e-15 AT1G06330 101 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1) Lus10008284 [exp] 64 / 1e-13 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1) Lus10033250 [exp] 64 / 1e-13 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1) Lus10020704 [exp] 63 / 2e-13 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 62 / 6e-13 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10041879 [exp] 62 / 6e-13 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 59 / 5e-12 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 59 / 5e-12 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10032445 [exp] 59 / 2e-11 AT1G23000 129 / 2e-34 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.018G150200.2 pacid=42801686 polypeptide=Potri.018G150200.2.p locus=Potri.018G150200 ID=Potri.018G150200.2.v4.1 annot-version=v4.1 ATGGAGGTTATCGAGTTGAAGGTGCATCTGCATTGCAAGGCCTGTGAGAAAGCAGTACGCAAAGCCTTGTGCAGGATCAAAGGGGTAACATGCGTGCAGA TCGATGGTATATCAAACAAGATTACAGTGATGGGGTATCTGGATAAAAAGATGGTGGTGAAAGCCATTTGGAAGACAGGGAGAAGGGCTGATGTGCTGCC ATCTTCTCCATCACCTCGCTTGGAGGCACCGGCGCCTAGTCCTAGATTGCCTACTGGCTTTCGGTGCATCATTCCAGCTAAATGGTGTTTCAAGAAACCA AATACCATTCCCAGAAGCACTGCTGTAACATCATGA
AA sequence Show only first row Show all	>Potri.018G150200.2 pacid=42801686 polypeptide=Potri.018G150200.2.p locus=Potri.018G150200 ID=Potri.018G150200.2.v4.1 annot-version=v4.1 MEVIELKVHLHCKACEKAVRKALCRIKGVTCVQIDGISNKITVMGYLDKKMVVKAIWKTGRRADVLPSSPSPRLEAPAPSPRLPTGFRCIIPAKWCFKKP NTIPRSTAVTS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06330			Heavy metal transport/detoxifi...		Potri.018G150200 [exp]	0	1
AT1G08010	GATA	GATA11	GATA transcription factor 11 (...		Potri.004G211800 [exp]	7.34	0.7175
AT2G07180			Protein kinase superfamily pro...		Potri.006G079600 [exp]	9.79	0.7338
AT3G07130		ATPAP15, PAP15	purple acid phosphatase 15 (.1...		Potri.017G055800 [exp]	12.24	0.7007
AT2G46225		ABIL1, ABI1L1	ABI-1-like 1 (.1.2.3)		Potri.014G092300 [exp]	12.88	0.7554
AT1G69420			DHHC-type zinc finger family p...		Potri.010G163200 [exp]	18.33	0.7026
AT2G16405			Transducin/WD40 repeat-like su...		Potri.009G121100 [exp]	22.22	0.6920
AT4G35240			Protein of unknown function (D...		Potri.002G011700 [exp]	25.39	0.6854
AT1G09610			Protein of unknown function (D...		Potri.019G076300 [exp]	25.78	0.7082
AT2G35110		NAPP, GRL, NAP1	NCK-ASSOCIATED PROTEIN 1, GNAR...		Potri.015G124500 [exp]	30.41	0.7183
AT4G10550			Subtilase family protein (.1.2...		Potri.011G146300 [exp]	31.96	0.6907

Compare expression of checked genes

Potri.018G150200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.