Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-BETA-TIP.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17810 350 / 8e-123 BETA-TIP beta-tonoplast intrinsic protein (.1) AT1G73190 346 / 4e-121 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT2G36830 266 / 5e-90 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT4G01470 259 / 3e-87 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT3G26520 251 / 5e-84 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT3G16240 233 / 1e-76 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT2G25810 216 / 4e-70 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT4G17340 213 / 5e-69 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT5G47450 209 / 2e-67 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT3G47440 166 / 1e-50 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G154800 [exp] 422 / 1e-151 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1) Potri.006G121700 [exp] 272 / 3e-92 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.016G098200 [exp] 271 / 8e-92 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.010G209900 [exp] 270 / 2e-91 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.008G050700 [exp] 268 / 1e-90 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.009G005400 [exp] 246 / 6e-82 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.004G216500 [exp] 244 / 6e-81 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1) Potri.001G235300 [exp] 243 / 6e-81 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1) Potri.009G027200 [exp] 242 / 2e-80 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036187 [exp] 392 / 2e-139 AT1G73190 382 / 4e-135 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) Lus10038324 [exp] 391 / 4e-139 AT1G73190 380 / 1e-134 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) Lus10040652 [exp] 378 / 6e-134 AT1G17810 367 / 2e-129 beta-tonoplast intrinsic protein (.1) Lus10018256 [exp] 375 / 8e-133 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1) Lus10023913 [exp] 271 / 8e-92 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10014411 [exp] 270 / 2e-91 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10021510 [exp] 268 / 1e-90 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10022611 [exp] 268 / 1e-90 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 268 / 2e-90 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10040863 [exp] 263 / 2e-88 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [poplar] [flax] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Potri.018G152100.1 pacid=42801584 polypeptide=Potri.018G152100.1.p locus=Potri.018G152100 ID=Potri.018G152100.1.v4.1 annot-version=v4.1 ATGCCTCGCAGATATGCATTTGGGAAGGCTGATGAGGCCACCCGCCCTGACGCCATGAGAGCCGCTTTGGCTGAATTGGTCTCCACTTTTATCTTTGTAT TTGCTGGCGAAGGCTCTATTCTTGCTCTCGATAAGTTATACAAGGGAACTGGGCCACCAGCTTCAGGGCTGCTGGTGGTCGCACTTGCACATGCATTGGC ACTGTTTTCTGCTGTGGCATCCAGCATCAACATATCAGGTGGCCATGTAAACCCTGCTGTTACCTTTGGCTCACTTGTTGGTGGCCGGATCTCGGTTATT CGAGCAGTCTCTTATTGGGTTGCTCAGCTCTTGGGTTCTATTTTCGCTGCTCTCTTGTTGAGGCTTGTCACCAATGGCATGATACCAGCTGGATTCCATG TGCAATCAGAGGTTGGAGAGGTGCATGGGCTTCTATTGGAAATGGCACTGACATTTGGACTGGTATACACAGTGTATGCAACAGCTATTGATCCCAAAAG GGGAAGCTTGGGGATCATTGCACCTCTAGCAATTGGGTTCGTCGTTGGGGCAAACATCTTGGTTGGTGGTCCATTTGATGGAGCATCAATGAACCCAGCA AGAGCATTTGGGCCTGCTCTAGTTGGGTGGAGATGGAGGAACCATTGGATCTACTGGGTTGGTCCTTTCCTTGGAGGAGGCTTGGCAGCCCTCATTTATG AGTACATTGTGATTTCAGCAGAGCCAGTAGCTCACCATACTCATCAGCATCAGCCCTTGGCTCCTGAAGATTACTAG
AA sequence Show only first row Show all	>Potri.018G152100.1 pacid=42801584 polypeptide=Potri.018G152100.1.p locus=Potri.018G152100 ID=Potri.018G152100.1.v4.1 annot-version=v4.1 MPRRYAFGKADEATRPDAMRAALAELVSTFIFVFAGEGSILALDKLYKGTGPPASGLLVVALAHALALFSAVASSINISGGHVNPAVTFGSLVGGRISVI RAVSYWVAQLLGSIFAALLLRLVTNGMIPAGFHVQSEVGEVHGLLLEMALTFGLVYTVYATAIDPKRGSLGIIAPLAIGFVVGANILVGGPFDGASMNPA RAFGPALVGWRWRNHWIYWVGPFLGGGLAALIYEYIVISAEPVAHHTHQHQPLAPEDY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17810		BETA-TIP	beta-tonoplast intrinsic prote...		Potri.018G152100 [exp]	0	1	Pt-BETA-TIP.1
AT4G21780			unknown protein		Potri.011G000400 [exp]	5.00	0.7863
AT3G47890			Ubiquitin carboxyl-terminal hy...		Potri.017G089250 [exp]	12.88	0.7722
					Potri.011G153800 [exp]	13.41	0.7192
AT5G19840			2-oxoglutarate (2OG) and Fe(II...		Potri.002G047875 [exp]	13.60	0.7379
AT2G43890			Pectin lyase-like superfamily ...		Potri.017G006700 [exp]	21.33	0.7189
AT4G22540		ORP2A	OSBP(oxysterol binding protein...		Potri.003G111600 [exp]	22.64	0.7690
AT1G55580	GRAS	SCL18, LAS	SCARECROW-LIKE 18, Lateral Sup...		Potri.001G473200 [exp]	32.21	0.7363
AT3G51840		ATG6, ATSCX, AC...	acyl-CoA oxidase 4 (.1)		Potri.006G101800 [exp]	42.00	0.7033	Pt-ACX4.1
AT1G55580	GRAS	SCL18, LAS	SCARECROW-LIKE 18, Lateral Sup...		Potri.015G008300 [exp]	48.51	0.7195
AT5G19580			glyoxal oxidase-related protei...		Potri.006G160800 [exp]	55.37	0.7175

Compare expression of checked genes

Potri.018G152100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.