Potri.019G000657 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36930 78 / 1e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT1G27180 72 / 1e-13 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT1G27170 72 / 2e-13 transmembrane receptors;ATP binding (.1.2)
AT5G45230 66 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G11250 65 / 3e-11 Disease resistance protein (TIR-NBS-LRR class) (.1)
AT5G41740 65 / 4e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT5G41750 62 / 3e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT3G25510 61 / 5e-10 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT3G44670 61 / 7e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT1G57650 60 / 1e-09 ATP binding (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T005501 656 / 0 AT5G36930 612 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G003942 578 / 0 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G003285 544 / 0 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G004599 240 / 2e-71 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G002628 199 / 3e-64 ND /
Potri.003G084366 192 / 6e-58 AT5G36930 145 / 2e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G007884 200 / 3e-57 AT5G36930 654 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.001G066500 166 / 9e-46 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G037599 166 / 2e-45 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039850 90 / 2e-19 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10018616 87 / 2e-18 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10003749 73 / 7e-14 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10011104 71 / 4e-13 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10029722 64 / 5e-11 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10011741 64 / 9e-11 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10042753 59 / 1e-09 AT4G12010 121 / 3e-30 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10005171 60 / 2e-09 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2)
Lus10016029 57 / 2e-08 AT4G12010 451 / 2e-138 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10012247 53 / 1e-07 AT5G45230 92 / 2e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info
Representative CDS sequence
>Potri.019G000657.1 pacid=42774695 polypeptide=Potri.019G000657.1.p locus=Potri.019G000657 ID=Potri.019G000657.1.v4.1 annot-version=v4.1
ATGCTACCTGCTTCTTTCACTAGTTTCAGCTCATTGAAAGAACTAAATCTAAGTTATTCTGGTTTGTCTGAAGCTACAAGTTCCATTGATCTTGGGAGTT
TGTGCTTTCTTGAAAATTTGAATTTGTCTGGACATGAATTCTTCAATCTGCCTTCTAGCATTAGCCGCCTTTCTAAGCTTCAATTTTTGACGGTTGAGAG
ATGCTCGAATCTTCTATCAATCTCAGAGCTTCCATCAAGTGTACTGTTCTTGTCTATCAATGACTGCACATCCATTGAAAGAGTAAGGGCACCACTTCAG
CATGAAAGACTACCATTACTGAATGTAAAAGGGTGCCGAAATTTAATAGAGATTCAGGGTATGGAATGTGCGGGCAATAACTGGTCCATTTTGAACTTAA
ATGGCTGCAACAATTTATCTGAAAACTATAAGATGAGTCTCATTCAGGGATTATGCAAAGGTAAACATTATGATATTTGCCTTGATGGTGGTGAGATACC
AGAATGGTTCAGCCATCGTGGAGAAGGATCTGCATTATCATTTCATTTTTCAGTTCCAGATGGTAACAAACTCCAAGCGCTGCTTCTTTGGGTTGTACTC
TCGGCCTCCACCAATGAAGCCACTCGAGAATCATCATTTCTCCAGTTTGATATGTGTGTTGCTACTTTCAAAAATAAGAGCAATGGTATTGAATTGTTTG
AGACGATGGCGGCAGTTACGTTTGACAGAACTATCACGAAGCATTCTTGGATACAGCATATACCGTTGATTGGGTTAGAGGAATCGCTGCAAGGTGTAGA
GGAATTGGAAGTGAATGTCAAAATAAGCTTATATGATGTTCCAAAATGTTGGGTAGAAAAATGTGGGGTACATTTGATAATGGAAAAGAATAAAGCAGAT
TCAGATCAGGAGATTGATATTAATGCTCTAGGCTCTGATGATCAGCTGTTGGAAAGTAGTTTGACAAGAGTTGCAGAAATGGAAAATCACCGGTTGCAGT
AA
AA sequence
>Potri.019G000657.1 pacid=42774695 polypeptide=Potri.019G000657.1.p locus=Potri.019G000657 ID=Potri.019G000657.1.v4.1 annot-version=v4.1
MLPASFTSFSSLKELNLSYSGLSEATSSIDLGSLCFLENLNLSGHEFFNLPSSISRLSKLQFLTVERCSNLLSISELPSSVLFLSINDCTSIERVRAPLQ
HERLPLLNVKGCRNLIEIQGMECAGNNWSILNLNGCNNLSENYKMSLIQGLCKGKHYDICLDGGEIPEWFSHRGEGSALSFHFSVPDGNKLQALLLWVVL
SASTNEATRESSFLQFDMCVATFKNKSNGIELFETMAAVTFDRTITKHSWIQHIPLIGLEESLQGVEELEVNVKISLYDVPKCWVEKCGVHLIMEKNKAD
SDQEIDINALGSDDQLLESSLTRVAEMENHRLQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G36930 Disease resistance protein (TI... Potri.019G000657 0 1
Potri.019G002628 2.82 0.8721
AT5G28780 PIF1 helicase (.1) Potri.011G042150 5.29 0.8172
AT5G26594 ARR24 response regulator 24 (.1) Potri.019G024900 7.48 0.8172
AT3G19280 FUCTA, FUCT1, A... fucosyltransferase 11 (.1) Potri.019G091200 8.36 0.8172 FUCT3.1
Potri.010G007833 15.09 0.7466
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Potri.004G036000 16.12 0.7444
AT5G36930 Disease resistance protein (TI... Potri.019G001314 16.58 0.7557
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Potri.011G028901 17.32 0.7276
AT5G36930 Disease resistance protein (TI... Potri.019G003942 19.79 0.7414
AT2G35615 Eukaryotic aspartyl protease f... Potri.003G105300 21.44 0.7134

Potri.019G000657 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.