Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26040 44 / 2e-06 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G001200 [exp] 103 / 9e-28 AT3G26040 236 / 6e-73 HXXXD-type acyl-transferase family protein (.1) Potri.019G001400 [exp] 99 / 5e-26 AT3G26040 223 / 6e-68 HXXXD-type acyl-transferase family protein (.1) Potri.015G127000 [exp] 83 / 3e-20 AT3G26040 241 / 6e-75 HXXXD-type acyl-transferase family protein (.1) Potri.006G036100 [exp] 74 / 6e-17 AT3G26040 250 / 2e-78 HXXXD-type acyl-transferase family protein (.1) Potri.001G310000 [exp] 67 / 2e-14 AT3G26040 249 / 5e-78 HXXXD-type acyl-transferase family protein (.1) Potri.015G126600 [exp] 66 / 6e-14 AT3G26040 264 / 5e-84 HXXXD-type acyl-transferase family protein (.1) Potri.006G034132 [exp] 58 / 7e-12 AT1G24420 78 / 2e-17 HXXXD-type acyl-transferase family protein (.1) Potri.005G028200 [exp] 55 / 5e-10 AT3G26040 232 / 1e-71 HXXXD-type acyl-transferase family protein (.1) Potri.008G034300 [exp] 52 / 3e-09 AT3G26040 280 / 1e-89 HXXXD-type acyl-transferase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036929 [exp] 42 / 1e-05 AT3G26040 319 / 1e-102 HXXXD-type acyl-transferase family protein (.1) Lus10037956 [exp] 39 / 0.0001 AT1G24430 220 / 5e-67 HXXXD-type acyl-transferase family protein (.1) Lus10039330 [exp] 39 / 0.0002 AT3G26040 240 / 2e-74 HXXXD-type acyl-transferase family protein (.1) Lus10030751 [exp] 38 / 0.0003 AT3G26040 297 / 2e-96 HXXXD-type acyl-transferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G001202.1 pacid=42774445 polypeptide=Potri.019G001202.1.p locus=Potri.019G001202 ID=Potri.019G001202.1.v4.1 annot-version=v4.1 ATGAGGTTGTCTCAAGCCAGACATGGCTGCATGAGGCCTTCCCTCATGAAAGTTCCAGTTAATTTGCGAGGAAAGATACCACAACCAATACCAGAAAATT CCTGTGGAAACCTGGTAAGCTGGGCAGTCGCTCAATTCAAGCCAGGTGATGAGAGCGAGGTGAAACTTCATGAATTGGTAAGTCGAATTAATAGCGGAAT TGAAAATGCTTTCCCAAATTATTCAAGGGAGTGTATTAGGCTTTTCGACACTAAAGATGTAATGGAATTGAGGCAATAG
AA sequence Show only first row Show all	>Potri.019G001202.1 pacid=42774445 polypeptide=Potri.019G001202.1.p locus=Potri.019G001202 ID=Potri.019G001202.1.v4.1 annot-version=v4.1 MRLSQARHGCMRPSLMKVPVNLRGKIPQPIPENSCGNLVSWAVAQFKPGDESEVKLHELVSRINSGIENAFPNYSRECIRLFDTKDVMELRQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.019G001202 [exp]	0	1
AT1G05020			ENTH/ANTH/VHS superfamily prot...		Potri.002G224500 [exp]	6.32	0.7728
					Potri.002G263451 [exp]	13.78	0.7858
					Potri.002G234850 [exp]	16.09	0.6027
					Potri.008G223900 [exp]	21.07	0.7738
					Potri.001G217950 [exp]	26.73	0.6528
					Potri.008G225101 [exp]	30.49	0.7591
AT1G08790			Protein of unknown function (D...		Potri.013G042400 [exp]	33.77	0.6421
					Potri.008G224138 [exp]	34.75	0.7573
AT4G19650			Mitochondrial transcription te...		Potri.015G115701 [exp]	35.94	0.7366
					Potri.008G225301 [exp]	37.22	0.7506

Compare expression of checked genes

Potri.019G001202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.