Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29670 76 / 5e-18 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G45670 74 / 4e-17 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT4G18970 70 / 8e-16 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT1G29660 69 / 3e-15 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G71250 60 / 3e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G37690 57 / 5e-11 SGNH hydrolase-type esterase superfamily protein (.1) AT1G33811 56 / 1e-10 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT2G19010 55 / 2e-10 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G71691 55 / 2e-10 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT5G15720 53 / 9e-10 GLIP7 GDSL-motif lipase 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G008300 [exp] 148 / 3e-45 AT1G29670 318 / 6e-107 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008000 [exp] 119 / 3e-34 AT1G29670 347 / 1e-118 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008402 [exp] 115 / 1e-32 AT1G29670 344 / 3e-117 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008406 [exp] 110 / 8e-31 AT1G29670 342 / 2e-116 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008902 [exp] 104 / 1e-28 AT1G29670 342 / 2e-116 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008906 [exp] 104 / 1e-28 AT1G29670 345 / 1e-117 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G005402 [exp] 104 / 1e-28 AT1G29670 341 / 3e-116 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G005400 [exp] 104 / 1e-28 AT1G29670 336 / 3e-114 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008404 [exp] 103 / 4e-28 AT1G29670 281 / 5e-92 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005414 [exp] 81 / 2e-19 AT5G45670 315 / 2e-105 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10015241 [exp] 78 / 1e-18 AT5G45670 315 / 1e-105 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10011997 [exp] 78 / 2e-18 AT5G45670 555 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10002777 [exp] 78 / 2e-18 AT5G45670 548 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10041847 [exp] 76 / 7e-18 AT1G29670 459 / 2e-162 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10011999 [exp] 76 / 1e-17 AT5G45670 328 / 5e-111 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10015242 [exp] 75 / 1e-17 AT5G45670 369 / 7e-128 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10002774 [exp] 73 / 7e-17 AT5G45670 328 / 1e-110 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10002775 [exp] 72 / 3e-16 AT1G29670 497 / 1e-177 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10011998 [exp] 69 / 3e-15 AT1G29670 493 / 4e-176 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G009300.1 pacid=42773307 polypeptide=Potri.019G009300.1.p locus=Potri.019G009300 ID=Potri.019G009300.1.v4.1 annot-version=v4.1 ATGTCATCTAGCGATCCTTCTGTGTCCGGGTCTAGGGTTGCAAACGTTGGATGTTGTCCTGTACTTGGTGGTGCATGTATTCTAGATTCAACCCCATGCG TAAACAGGACTGAATATGTTTTCTGGGATGCAATTCATCCCACCGAATCTTCGAACCAATTCACTGCTAGAAGATCGTATTCTGCTTTTCTTCCATCTGA TGCTTATCCATACGATATCAGCCATTTAGTTAACATGCAGATCTAA
AA sequence Show only first row Show all	>Potri.019G009300.1 pacid=42773307 polypeptide=Potri.019G009300.1.p locus=Potri.019G009300 ID=Potri.019G009300.1.v4.1 annot-version=v4.1 MSSSDPSVSGSRVANVGCCPVLGGACILDSTPCVNRTEYVFWDAIHPTESSNQFTARRSYSAFLPSDAYPYDISHLVNMQI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G009300 [exp]	0	1
					Potri.018G004701 [exp]	10.72	0.8261
AT1G78260			RNA-binding (RRM/RBD/RNP motif...		Potri.002G098100 [exp]	16.06	0.8617
					Potri.001G049501 [exp]	22.31	0.9135
AT5G65207			unknown protein		Potri.005G081400 [exp]	23.45	0.8964
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Potri.002G244200 [exp]	32.20	0.8499	Pt-XTH2.1
AT4G27450			Aluminium induced protein with...		Potri.011G049900 [exp]	32.86	0.8719
					Potri.001G021300 [exp]	33.25	0.8903
AT3G16660			Pollen Ole e 1 allergen and ex...		Potri.010G012400 [exp]	34.23	0.9097
AT5G14410			unknown protein		Potri.001G342100 [exp]	34.72	0.8860
AT5G05800			unknown protein		Potri.011G125150 [exp]	40.55	0.8635

Compare expression of checked genes

Potri.019G009300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.