Potri.019G010600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49230 158 / 1e-48 RING/U-box superfamily protein (.1)
AT1G49200 139 / 4e-41 RING/U-box superfamily protein (.1)
AT1G49210 138 / 1e-40 RING/U-box superfamily protein (.1)
AT1G49220 136 / 1e-39 RING/U-box superfamily protein (.1)
AT3G18773 135 / 1e-39 RING/U-box superfamily protein (.1)
AT5G05280 115 / 3e-32 RING/U-box superfamily protein (.1)
AT5G01880 104 / 2e-28 RING/U-box superfamily protein (.1)
AT3G10910 101 / 6e-27 RING/U-box superfamily protein (.1)
AT1G76410 101 / 1e-26 ATL8 RING/U-box superfamily protein (.1)
AT2G17450 100 / 3e-26 RHA3A RING-H2 finger A3A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G309700 257 / 1e-87 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.001G309600 193 / 2e-62 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.019G010500 184 / 2e-58 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.013G091300 120 / 8e-34 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.019G057700 115 / 5e-32 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.016G136200 114 / 7e-32 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.001G159300 104 / 2e-28 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.005G099000 105 / 3e-28 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Potri.003G075200 104 / 3e-28 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005814 151 / 8e-46 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Lus10006788 150 / 4e-45 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1)
Lus10020859 150 / 6e-45 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
Lus10033515 149 / 1e-44 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
Lus10005817 148 / 3e-44 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1)
Lus10005815 145 / 1e-43 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1)
Lus10006785 140 / 1e-41 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
Lus10005818 130 / 4e-38 AT1G49230 140 / 1e-42 RING/U-box superfamily protein (.1)
Lus10006786 129 / 2e-37 AT1G49230 176 / 9e-56 RING/U-box superfamily protein (.1)
Lus10006787 129 / 3e-37 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.019G010600.1 pacid=42773857 polypeptide=Potri.019G010600.1.p locus=Potri.019G010600 ID=Potri.019G010600.1.v4.1 annot-version=v4.1
ATGTCTTCTACTTTTTCCACACCCCCTCTACCTTTCCAACATTTTCATGGTGTTTTTCACCTAAGAAAATTGCTACTACACAACCCTCTTTCTCCTTTAC
CTTCTAGTAACGCCCATCATCCATTGAATCCTAACGCCACAGGGGATAAGAGCTTCAATATAAATGTTGTTGTTGTCTTTATAGTCCTAATGTGTGCACT
CTTTAGTTCACTTGGGCTAAATTCTTTCGTAAGGTGTGCATTATGGTGTTCAAACGTAAATGGAAATTCTTCCAATAGAGGGATCAAGAAAAAAGCCTTG
AAAACTTTCCCTGTAGTGAATTACTCAGCAAAGGATAGTAAATTGCCTGGGTTGGACACAGAATGTGTCATATGCATATCAGAGTTTGTATTTGGTGATC
GTGTTCGAATTTTGCCAAAGTGTAGCCATGTATTTCATGTGAGGTGCATTGATATGTGGCTCAGCTCACACTCATCTTGCCCGACATGCAGGCACTGCCT
TAAGGAGACATGCCACAAGATTGCTGGTGTTAGTCAGGCTAGCTCATCAGAACAACCACCTCCTCCCATCCAAGAAAGAGTTGTGAACATTGCACCCCTC
GAGCGTGAAGGTTTGGTCAGCAATTACAGGGGAGTCAGCTAA
AA sequence
>Potri.019G010600.1 pacid=42773857 polypeptide=Potri.019G010600.1.p locus=Potri.019G010600 ID=Potri.019G010600.1.v4.1 annot-version=v4.1
MSSTFSTPPLPFQHFHGVFHLRKLLLHNPLSPLPSSNAHHPLNPNATGDKSFNINVVVVFIVLMCALFSSLGLNSFVRCALWCSNVNGNSSNRGIKKKAL
KTFPVVNYSAKDSKLPGLDTECVICISEFVFGDRVRILPKCSHVFHVRCIDMWLSSHSSCPTCRHCLKETCHKIAGVSQASSSEQPPPPIQERVVNIAPL
EREGLVSNYRGVS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G49230 RING/U-box superfamily protein... Potri.019G010600 0 1
AT5G36930 Disease resistance protein (TI... Potri.011G012000 7.93 0.7729
AT5G22355 Cysteine/Histidine-rich C1 dom... Potri.016G044732 9.16 0.7409
AT5G57685 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, A... Potri.006G267900 11.83 0.7262
AT4G24015 RING/U-box superfamily protein... Potri.001G088400 18.43 0.6254
AT4G27220 NB-ARC domain-containing disea... Potri.018G145582 21.07 0.7033
AT5G22355 Cysteine/Histidine-rich C1 dom... Potri.016G047000 29.89 0.7355
AT5G67620 unknown protein Potri.007G005600 35.88 0.6949
AT3G14470 NB-ARC domain-containing disea... Potri.012G121750 38.34 0.6795
AT1G14920 GRAS RGA2, GAI RESTORATION ON GROWTH ON AMMON... Potri.004G070500 44.09 0.6744
AT4G27220 NB-ARC domain-containing disea... Potri.018G145578 52.85 0.6891

Potri.019G010600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.