Potri.019G012000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05430 155 / 4e-49 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G30933 106 / 8e-29 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT1G09460 107 / 2e-28 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G56590 108 / 6e-28 O-Glycosyl hydrolases family 17 protein (.1)
AT1G66870 100 / 7e-28 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G66250 107 / 2e-27 O-Glycosyl hydrolases family 17 protein (.1)
AT1G29380 105 / 2e-27 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G55180 106 / 3e-27 O-Glycosyl hydrolases family 17 protein (.1.2)
AT2G05790 105 / 4e-27 O-Glycosyl hydrolases family 17 protein (.1)
AT3G58100 100 / 1e-26 PDCB5 plasmodesmata callose-binding protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G007800 317 / 2e-112 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.007G111000 247 / 1e-84 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.018G068600 130 / 6e-36 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.005G003500 117 / 1e-30 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.013G003500 114 / 7e-30 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G078500 108 / 4e-29 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G353400 108 / 4e-29 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G059600 104 / 6e-28 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.005G202400 101 / 1e-26 AT2G30933 140 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023276 194 / 1e-63 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10038529 181 / 5e-58 AT4G05430 146 / 9e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10034987 120 / 2e-32 AT5G56590 562 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10012937 120 / 2e-32 AT5G56590 617 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10015151 114 / 6e-30 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10007342 106 / 2e-28 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10004546 107 / 3e-28 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10004600 106 / 5e-28 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10018306 107 / 1e-27 AT5G55180 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10001516 105 / 4e-27 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Potri.019G012000.1 pacid=42774229 polypeptide=Potri.019G012000.1.p locus=Potri.019G012000 ID=Potri.019G012000.1.v4.1 annot-version=v4.1
ATGAGAAACGAAGTAATGGTTTTGCCATGTCTCTTGTTGCTGCATTGTTATGTAGTCCTGACAATGGAGACTATAACGCAAGAGAAAGCAGAGGCTGCTA
TCCCAGTCACAACATTGTCACCTCCAGAAGGAAACACAACTTTTCTTGCTGGAACCTCATGGTGTGTAGCCCTTCCAGGTGTCTCTCAAATTGATTTACA
GAACGCGTTAGACTGGGCCTGTGGTCTAGGCATGGCAGATTGTAAACCAATCCAACATGGTGGAGCGTGTTTCGATCCTGACACACTCGTGTCTCATGCC
TCCTATGCTTTCAACAACTATTACCAACAAAATGGGAATTCTGATATAGCTTGCAATTTTGGAGGAACTGCTACTCTAACCAACATTGATCCCAGTCATG
GAAAATGTAACTTTGCTTCACCTGGATCTGTCGGGTCGTCAGCACCTTCTTCACTCAAGTGCAAAACAAGCTTTATATGGGTGAAGTTTGCTGGGATTTT
GCTGCTTTTGTACTTGAGAAGATAA
AA sequence
>Potri.019G012000.1 pacid=42774229 polypeptide=Potri.019G012000.1.p locus=Potri.019G012000 ID=Potri.019G012000.1.v4.1 annot-version=v4.1
MRNEVMVLPCLLLLHCYVVLTMETITQEKAEAAIPVTTLSPPEGNTTFLAGTSWCVALPGVSQIDLQNALDWACGLGMADCKPIQHGGACFDPDTLVSHA
SYAFNNYYQQNGNSDIACNFGGTATLTNIDPSHGKCNFASPGSVGSSAPSSLKCKTSFIWVKFAGILLLLYLRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G05430 Carbohydrate-binding X8 domain... Potri.019G012000 0 1
AT4G05430 Carbohydrate-binding X8 domain... Potri.019G007800 1.73 0.9917
AT1G77700 Pathogenesis-related thaumatin... Potri.001G210400 2.44 0.9914
AT2G16050 Cysteine/Histidine-rich C1 dom... Potri.004G209200 3.00 0.9891
AT3G14310 ATPME3 pectin methylesterase 3 (.1) Potri.006G256700 5.00 0.9860
AT1G63310 unknown protein Potri.001G452900 6.00 0.9866
AT5G42146 unknown protein Potri.004G167800 6.16 0.9700
Potri.001G393001 6.48 0.9850
AT2G21080 unknown protein Potri.018G002700 7.93 0.9771
AT1G79480 Carbohydrate-binding X8 domain... Potri.010G173500 8.12 0.9766
Potri.018G040000 8.48 0.9804

Potri.019G012000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.