Potri.019G012900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G012702 225 / 4e-78 AT2G31335 / unknown protein
Potri.019G012601 218 / 3e-75 AT2G31335 / unknown protein
Potri.019G013000 200 / 4e-68 AT2G31335 / unknown protein
Potri.019G012700 196 / 1e-66 AT2G31335 / unknown protein
Potri.019G012400 192 / 4e-65 AT2G31335 / unknown protein
Potri.013G043600 157 / 3e-51 AT1G06135 39 / 3e-05 unknown protein
Potri.019G012603 139 / 2e-44 AT2G31335 / unknown protein
Potri.010G075133 72 / 8e-18 AT2G31335 / unknown protein
Potri.008G163000 61 / 2e-13 AT2G31335 40 / 1e-05 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041164 50 / 4e-09 ND 34 / 0.002
Lus10006567 48 / 5e-08 ND 35 / 0.001
Lus10005525 47 / 7e-08 ND 40 / 1e-05
Lus10024873 41 / 1e-05 ND 37 / 2e-04
Lus10024872 40 / 4e-05 ND 39 / 3e-05
Lus10041163 39 / 0.0001 ND 34 / 0.002
PFAM info
Representative CDS sequence
>Potri.019G012900.1 pacid=42773596 polypeptide=Potri.019G012900.1.p locus=Potri.019G012900 ID=Potri.019G012900.1.v4.1 annot-version=v4.1
ATGGGTTCTCAAAGAAAAAACCAGTGCTTAACGATGATAATCTTTGTTGCCGCTGTTTTTGGACCATGCTTTCAACAAATATTGGCAGGTAGGCCATTAG
AAGGAGAGCAATGGTTAAAGCAAAATCTTGGGAATATTCAATCTCTTCAAAAGGGTGGATCTCAATGCACTCATATTCCTGGCCATGGTAGTGGCCATTG
CCCCTTGGGTGAAATGAATTTTGCTGGCAATATTGTTGCTCATGCACCACCTGCTTTTCCTGATGCCATCGTAAACTTTGCTGCAGCTTCAGTCACTAAT
AATGAGACCCAAAAACAAGATTCAAGCTCATGA
AA sequence
>Potri.019G012900.1 pacid=42773596 polypeptide=Potri.019G012900.1.p locus=Potri.019G012900 ID=Potri.019G012900.1.v4.1 annot-version=v4.1
MGSQRKNQCLTMIIFVAAVFGPCFQQILAGRPLEGEQWLKQNLGNIQSLQKGGSQCTHIPGHGSGHCPLGEMNFAGNIVAHAPPAFPDAIVNFAAASVTN
NETQKQDSSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G31335 unknown protein Potri.019G012900 0 1
AT2G31335 unknown protein Potri.019G012702 1.00 0.9788
AT2G31335 unknown protein Potri.019G012601 18.16 0.9626
Potri.006G106150 19.64 0.9738
AT1G20560 AAE1 acyl activating enzyme 1 (.1.2... Potri.007G059401 26.45 0.9730
AT1G35210 unknown protein Potri.005G161700 28.00 0.9731
AT4G27290 S-locus lectin protein kinase ... Potri.001G412400 33.94 0.9728
AT4G14746 unknown protein Potri.013G039300 36.66 0.9724 Pt-MTN26.2
Potri.010G218500 38.98 0.9722
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Potri.001G223700 39.34 0.9721
AT3G60120 BGLU27 beta glucosidase 27 (.1) Potri.001G224000 43.12 0.9719

Potri.019G012900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.