Potri.019G013000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06137 36 / 0.0006 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G012700 221 / 2e-76 AT2G31335 / unknown protein
Potri.019G012400 216 / 1e-74 AT2G31335 / unknown protein
Potri.019G012900 200 / 4e-68 AT2G31335 / unknown protein
Potri.019G012702 198 / 2e-67 AT2G31335 / unknown protein
Potri.019G012601 197 / 4e-67 AT2G31335 / unknown protein
Potri.013G043600 181 / 1e-60 AT1G06135 39 / 3e-05 unknown protein
Potri.019G012603 157 / 2e-51 AT2G31335 / unknown protein
Potri.010G075133 84 / 3e-22 AT2G31335 / unknown protein
Potri.008G162900 76 / 3e-19 AT2G31335 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006567 61 / 5e-13 ND 35 / 0.001
Lus10041164 61 / 6e-13 ND 34 / 0.002
Lus10005525 59 / 2e-12 ND 40 / 1e-05
Lus10041163 53 / 5e-10 ND 34 / 0.002
Lus10024873 50 / 5e-09 ND 37 / 2e-04
Lus10024872 48 / 5e-08 ND 39 / 3e-05
Lus10000703 40 / 6e-05 AT1G06135 44 / 3e-07 unknown protein
Lus10014739 37 / 0.0007 ND 40 / 2e-05
PFAM info
Representative CDS sequence
>Potri.019G013000.1 pacid=42773876 polypeptide=Potri.019G013000.1.p locus=Potri.019G013000 ID=Potri.019G013000.1.v4.1 annot-version=v4.1
ATGGGTTCTCAAAGAAAAAACCAATGCTTAACAATGACAATCTTTGTTGCCATTGTTTTTGGACCATGCTCTCACCAAATATTGGCAGCTAGGCCATTAG
AGGGAGAGCAATGGTTAAAGCAAAATCTTGGGAATATTCAATCTCTTCGAAGGGGTCCGGTTCCACCATCTGGTGGATCTTCATGCACTCATATTCCTGG
CCGTGGTAGTGGCCATTGCCCCTTGGGTGAAATGAATTTTGCTGGCCATATTGTTGCTCATGCACCACCTGCTTTTCCTGATGCCATCGTAAAGTTTGCT
GCGGCTTCAGTCACTAATAATGAGACCCAAAAACAAGATTCAAGCTCATGA
AA sequence
>Potri.019G013000.1 pacid=42773876 polypeptide=Potri.019G013000.1.p locus=Potri.019G013000 ID=Potri.019G013000.1.v4.1 annot-version=v4.1
MGSQRKNQCLTMTIFVAIVFGPCSHQILAARPLEGEQWLKQNLGNIQSLRRGPVPPSGGSSCTHIPGRGSGHCPLGEMNFAGHIVAHAPPAFPDAIVKFA
AASVTNNETQKQDSSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G31335 unknown protein Potri.019G013000 0 1
AT2G20900 DGK5, ATDGK5 diacylglycerol kinase 5 (.1.2.... Potri.013G148500 13.30 0.6413
AT1G76390 PUB43 plant U-box 43, ARM repeat sup... Potri.002G007800 24.97 0.6482
AT5G37490 ARM repeat superfamily protein... Potri.008G137700 26.88 0.7176
AT1G76390 PUB43 plant U-box 43, ARM repeat sup... Potri.002G175800 45.60 0.6618
AT4G13810 AtRLP47 receptor like protein 47 (.1.2... Potri.012G019850 51.61 0.6200
AT2G23770 protein kinase family protein ... Potri.014G040000 75.31 0.6635
AT2G20562 unknown protein Potri.011G114600 89.43 0.6146
AT2G33060 AtRLP27 receptor like protein 27 (.1) Potri.012G026600 91.43 0.6280
AT5G45290 RING/U-box superfamily protein... Potri.014G053500 155.17 0.5942
AT3G03050 RHD7, ATCSLD3, ... ROOT HAIR DEFECTIVE 7, KOJAK, ... Potri.019G049700 208.49 0.5900 PtrCSLD1,CESA3.2

Potri.019G013000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.