Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41180 46 / 3e-07 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1) AT3G56710 45 / 2e-06 SIB1 sigma factor binding protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G013750 [exp] 242 / 3e-84 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1) Potri.013G043800 [exp] 167 / 9e-55 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.016G093900 [exp] 160 / 5e-52 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.003G194700 [exp] 57 / 4e-11 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1) Potri.001G029700 [exp] 55 / 1e-10 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1) Potri.016G036600 [exp] 56 / 2e-10 AT3G56710 48 / 2e-07 sigma factor binding protein 1 (.1) Potri.006G038900 [exp] 54 / 6e-10 AT2G41180 56 / 2e-10 sigma factor binding protein 2, VQ motif-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005523 [exp] 66 / 2e-14 ND 46 / 2e-06 Lus10006569 [exp] 63 / 4e-13 ND 44 / 1e-05 Lus10022005 [exp] 60 / 3e-12 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1) Lus10024139 [exp] 51 / 1e-08 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1) Lus10039494 [exp] 46 / 7e-07 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1) Lus10039493 [exp] 44 / 3e-06 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1) Lus10026165 [exp] 42 / 1e-05 AT3G56710 44 / 3e-06 sigma factor binding protein 1 (.1) Lus10008659 [exp] 40 / 9e-05 ND 44 / 4e-06
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [poplar] [flax] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Potri.019G013300.2 pacid=42774425 polypeptide=Potri.019G013300.2.p locus=Potri.019G013300 ID=Potri.019G013300.2.v4.1 annot-version=v4.1 ATGAGCACCTTTAGGGAACAGTGTTTTTCCCAGCAAGAACAACCAAAAAAGGGCCAAAAATCCACCAAGAACAAGAGAGAACCAATCAAGATTAAATACA TTTCAAGCCCAACAATGGTTAAAGCAACTAATGCCACTGAGTTTAGGGCAATCGTTCAAGAATTAACAGGCAAAGATTCCAAAGTTGAAGATCCCTGTGA TGCCAATGAAGAAGCCAGTCAAGTTCCTCGCCATGGAACCCCTCGGTTTGATGTGGAAAGTGTGGATGGTGCTTTTTGCAACAATACATCTCCATTTTTA CAGAAAGAAGATGGTTTCGTTTGGGGAGATGTTTCTGAGAGGGCTTTTGAACTTCAATATCCTTGTGTTTTTGTATGA
AA sequence Show only first row Show all	>Potri.019G013300.2 pacid=42774425 polypeptide=Potri.019G013300.2.p locus=Potri.019G013300 ID=Potri.019G013300.2.v4.1 annot-version=v4.1 MSTFREQCFSQQEQPKKGQKSTKNKREPIKIKYISSPTMVKATNATEFRAIVQELTGKDSKVEDPCDANEEASQVPRHGTPRFDVESVDGAFCNNTSPFL QKEDGFVWGDVSERAFELQYPCVFV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G41180		SIB2	sigma factor binding protein 2...		Potri.019G013300 [exp]	0	1
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Potri.016G137400 [exp]	1.00	0.9662
AT4G32180		ATPANK2	pantothenate kinase 2 (.1.2.3)		Potri.010G041800 [exp]	2.82	0.9486
AT5G05600			2-oxoglutarate (2OG) and Fe(II...		Potri.010G188000 [exp]	5.29	0.9305
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Potri.005G223100 [exp]	5.29	0.9362
AT3G61850	DOF	DAG1, AtDof3,7	dof affecting germination 1, D...		Potri.014G100900 [exp]	5.47	0.9335	DAG1.2
AT2G26530		AR781	Protein of unknown function (D...		Potri.014G034900 [exp]	5.91	0.9346	AR781.2
AT1G76490		HMGR1, HMG1, At...	3-HYDROXY-3-METHYLGLUTARYL COA...		Potri.004G208500 [exp]	6.00	0.9415	HMGR3.4
AT5G42440			Protein kinase superfamily pro...		Potri.002G065400 [exp]	9.74	0.9133
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Potri.003G081200 [exp]	10.39	0.9257
AT2G26190			calmodulin-binding family prot...		Potri.006G147900 [exp]	10.58	0.9167

Compare expression of checked genes

Potri.019G013300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.