Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG00820 109 / 7e-33 ATCG00820.1, RPS19 ribosomal protein S19 (.1) AT5G47320 45 / 8e-07 RPS19 ribosomal protein S19 (.1) AT5G63070 39 / 0.0001 Ribosomal protein S19 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G137688 [exp] 121 / 7e-38 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1) Potri.005G154674 [exp] 120 / 3e-37 ATCG00820 167 / 9e-56 ribosomal protein S19 (.1) Potri.011G074301 [exp] 117 / 3e-36 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1) Potri.013G129600 [exp] 42 / 3e-06 AT5G47320 103 / 2e-28 ribosomal protein S19 (.1) Potri.019G101950 [exp] 37 / 0.0001 AT5G47320 74 / 1e-17 ribosomal protein S19 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027711 [exp] 43 / 1e-06 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1) Lus10003009 [exp] 44 / 3e-06 AT5G47040 1420 / 0.0 lon protease 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00203 [poplar] [flax] Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence Show only first row Show all	>Potri.019G013302.1 pacid=42774319 polypeptide=Potri.019G013302.1.p locus=Potri.019G013302 ID=Potri.019G013302.1.v4.1 annot-version=v4.1 ATGGATTTTTTAAAAATATTTTTAAATAATTACCAACAGAATTACATAAGGCAAAAAAATAAAATAGTAACGTGGTCCCAGGCATCCACCATTACACCCA TAATGATCGGTTATACTATTGTTATCCATAATGGGAAGGAGAATTTACCTATTTATATAACAGATCGTATGGTAGGTCATAAATTAGGAGAATTTGCACC TACTCTTAATTTCCAGGGACATGCAAAAAATGATAATAAATCTCATCGTTAA
AA sequence Show only first row Show all	>Potri.019G013302.1 pacid=42774319 polypeptide=Potri.019G013302.1.p locus=Potri.019G013302 ID=Potri.019G013302.1.v4.1 annot-version=v4.1 MDFLKIFLNNYQQNYIRQKNKIVTWSQASTITPIMIGYTIVIHNGKENLPIYITDRMVGHKLGEFAPTLNFQGHAKNDNKSHR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
ATCG00820		ATCG00820.1, RP...	ribosomal protein S19 (.1)		Potri.019G013302 [exp]	0	1
					Potri.014G186308 [exp]	11.00	0.8207
ATCG01130		ATCG01130.1, YC...	Ycf1 protein (.1)		Potri.013G075166 [exp]	27.34	0.8022
AT1G76810			eukaryotic translation initiat...		Potri.019G103600 [exp]	33.39	0.8002
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Potri.011G084201 [exp]	40.39	0.7997
					Potri.007G062102 [exp]	44.45	0.7939
					Potri.005G150475 [exp]	49.35	0.7911
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Potri.013G138900 [exp]	55.99	0.7919
AT4G36520			Chaperone DnaJ-domain superfam...		Potri.005G120700 [exp]	63.79	0.7761
ATCG01130		ATCG01130.1, YC...	Ycf1 protein (.1)		Potri.010G052900 [exp]	64.12	0.7832
AT5G06790			unknown protein		Potri.006G191100 [exp]	69.33	0.7817

Compare expression of checked genes

Potri.019G013302 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.