Plant FIBer expression Database

Potri.019G014344 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01060 139 / 3e-45 ATCG01060.1, PSAC iron-sulfur cluster binding;electron carriers;4 iron, 4 sulfur cluster binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0344 4Fe-4S PF13187 Fer4_9 4Fe-4S dicluster domain
Representative CDS sequence
>Potri.019G014344.1 pacid=42773061 polypeptide=Potri.019G014344.1.p locus=Potri.019G014344 ID=Potri.019G014344.1.v4.1 annot-version=v4.1
ATGTCACATTCAGTAAAAATCTATGATACATGTATAAGGTGTATTCAATGTGTCCAGGCCTGCCCCATGGATGTATTAGAAATGATACCTGGGGACGGGT
GTATAGCTAAGCAAATTACTTCTGCTCCAAGAACAGAAGACTGTGTTGGCTATAAGAGATGTGAATCCGCCTGTCCAATAAATTTCTTAAGTATTCGAGT
TTATCTATGGCATGAAAAAACTCAAAGCATAGGTCTATTTTATTAA
AA sequence
>Potri.019G014344.1 pacid=42773061 polypeptide=Potri.019G014344.1.p locus=Potri.019G014344 ID=Potri.019G014344.1.v4.1 annot-version=v4.1
MSHSVKIYDTCIRCIQCVQACPMDVLEMIPGDGCIAKQITSAPRTEDCVGYKRCESACPINFLSIRVYLWHEKTQSIGLFY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01060 ATCG01060.1, PS... iron-sulfur cluster binding;el... Potri.019G014344
[exp]
0 1
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G113784
[exp]
2.23 0.9514
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G074700
[exp]
3.46 0.9353
ATCG00280 ATCG00280.1, PS... photosystem II reaction center... Potri.013G142760
[exp]
6.32 0.9251
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.013G142201
[exp]
7.93 0.9031
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.007G062202
[exp]
8.48 0.9052
ATCG00020 ATCG00020.1, PS... photosystem II reaction center... Potri.005G154836
[exp]
9.38 0.8301
AT4G16515 RGF6 root meristem growth factor 6,... Potri.007G077300
[exp]
11.35 0.7756
ATCG00330 ATCG00330.1, RP... chloroplast ribosomal protein ... Potri.013G142336
[exp]
13.41 0.8485
ATCG01050 ATCG01050.1, ND... NADH-Ubiquinone/plastoquinone ... Potri.008G202133
[exp]
13.74 0.8317
ATCG00300 ATCG00300.1, YC... YCF9 (.1) Potri.013G142548
[exp]
15.49 0.8384

Potri.019G014344 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.