Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56070 277 / 1e-96 ROC2 rotamase cyclophilin 2 (.1.2) AT2G16600 256 / 3e-88 ROC3 rotamase CYP 3 (.1.2) AT2G21130 247 / 6e-85 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G34870 245 / 3e-84 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT4G38740 243 / 3e-83 ROC1 rotamase CYP 1 (.1) AT2G29960 226 / 2e-76 CYP19-4, ATCYP5, CYP5 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) AT5G58710 218 / 7e-73 ROC7 rotamase CYP 7 (.1) AT3G55920 216 / 1e-71 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G63400 205 / 1e-65 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT2G15790 196 / 4e-62 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G240200 [exp] 258 / 3e-89 AT2G16600 276 / 2e-96 rotamase CYP 3 (.1.2) Potri.009G130100 [exp] 256 / 2e-88 AT2G21130 279 / 1e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.004G168800 [exp] 255 / 6e-88 AT2G16600 278 / 4e-97 rotamase CYP 3 (.1.2) Potri.002G021500 [exp] 253 / 4e-87 AT2G16600 278 / 2e-97 rotamase CYP 3 (.1.2) Potri.009G046500 [exp] 218 / 5e-73 AT2G29960 323 / 4e-114 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Potri.001G251700 [exp] 218 / 1e-72 AT5G58710 313 / 6e-110 rotamase CYP 7 (.1) Potri.010G189000 [exp] 216 / 1e-71 AT3G55920 303 / 4e-105 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G135500 [exp] 200 / 6e-64 AT2G15790 553 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.009G106200 [exp] 200 / 8e-64 AT2G15790 561 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042553 [exp] 284 / 3e-99 AT3G56070 297 / 1e-104 rotamase cyclophilin 2 (.1.2) Lus10022012 [exp] 280 / 1e-97 AT3G56070 295 / 1e-103 rotamase cyclophilin 2 (.1.2) Lus10012167 [exp] 259 / 9e-90 AT2G16600 313 / 4e-111 rotamase CYP 3 (.1.2) Lus10007579 [exp] 258 / 4e-89 AT2G16600 311 / 2e-110 rotamase CYP 3 (.1.2) Lus10017258 [exp] 247 / 8e-85 AT2G16600 308 / 6e-109 rotamase CYP 3 (.1.2) Lus10013552 [exp] 237 / 7e-81 AT2G16600 297 / 1e-104 rotamase CYP 3 (.1.2) Lus10018238 [exp] 223 / 8e-75 AT2G29960 348 / 4e-124 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10040666 [exp] 223 / 9e-75 AT5G58710 347 / 2e-123 rotamase CYP 7 (.1) Lus10014846 [exp] 223 / 2e-73 AT2G29960 310 / 6e-107 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10030408 [exp] 207 / 4e-67 AT3G55920 333 / 5e-116 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [poplar] [flax] Cyclophil-like PF00160 [poplar] [flax] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Potri.019G014396.1 pacid=42773774 polypeptide=Potri.019G014396.1.p locus=Potri.019G014396 ID=Potri.019G014396.1.v4.1 annot-version=v4.1 ATGTCGAATCCGAAGGTTTTCTTTGACATTCTAATTGGCAAGATGAAAGCAGGTAGGATTGTGATGGAACTATTTGCTGATGCTACTCCGAAAACTGCTG AAAATTTCCGTGCTCTATGCACCGGGGAGAAAGGGATTGGAAATGCTGGGAAACCATTACACTATAAGGGTTCGACTTTCCATCGCATAATCCCAAACTT CATGTGTCAAGGTGGGGATTTTACTAGGGGTAATGGAACTGGAGGAGAATCAATCTATGGCGCAAAGTTTGCAGATGAGAACTTTAAGCTGAAGCATACA GGGCCTGGTGTTTTATCAATGGCAAATTCTGGACCGAACACTAATGGTTCCCAATTCTTCATTTGCACTGAGAATACCTCATGGCTTGATGGGAAACATG TTGTTTTTGGGAAAGTTGTAGATGGCTATGGCGTTGTTCAGGAAATGGAGAAGGTAGGGTCCAATAGTGGGACGACAAAGGAAACTGTTATTGTTGAAGA TTGTGGTCAAATAATAGAGAACTGA
AA sequence Show only first row Show all	>Potri.019G014396.1 pacid=42773774 polypeptide=Potri.019G014396.1.p locus=Potri.019G014396 ID=Potri.019G014396.1.v4.1 annot-version=v4.1 MSNPKVFFDILIGKMKAGRIVMELFADATPKTAENFRALCTGEKGIGNAGKPLHYKGSTFHRIIPNFMCQGGDFTRGNGTGGESIYGAKFADENFKLKHT GPGVLSMANSGPNTNGSQFFICTENTSWLDGKHVVFGKVVDGYGVVQEMEKVGSNSGTTKETVIVEDCGQIIEN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56070		ROC2	rotamase cyclophilin 2 (.1.2)		Potri.019G014396 [exp]	0	1
AT3G17465		RPL3P	ribosomal protein L3 plastid (...		Potri.008G207000 [exp]	2.00	0.8918	RPL3.2
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Potri.009G158700 [exp]	5.29	0.8780	Pt-RPL30.2
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.001G452100 [exp]	6.70	0.8865	TIM13.1
AT1G14980		CPN10	chaperonin 10 (.1)		Potri.001G274300 [exp]	10.39	0.8946	CPN10.3
AT5G16060			Cytochrome c oxidase biogenesi...		Potri.017G113401 [exp]	10.95	0.8282
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Potri.001G390400 [exp]	13.37	0.7669
AT2G45440		DHDPS2	dihydrodipicolinate synthase (...		Potri.002G149500 [exp]	15.19	0.8059	Pt-DHDPS2.1
AT5G27400			S-adenosyl-L-methionine-depend...		Potri.005G039000 [exp]	15.29	0.8057
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Potri.005G098100 [exp]	16.52	0.8564	LOS1.3
AT5G48760			Ribosomal protein L13 family p...		Potri.001G314500 [exp]	16.55	0.8955	RPL13.1

Compare expression of checked genes

Potri.019G014396 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.