Plant FIBer expression Database

Potri.019G015800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G015900
[exp]
103 / 6e-30 ND /
Potri.019G016108
[exp]
102 / 1e-29 ND /
Potri.019G016000
[exp]
99 / 4e-28 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.019G015800.1 pacid=42773515 polypeptide=Potri.019G015800.1.p locus=Potri.019G015800 ID=Potri.019G015800.1.v4.1 annot-version=v4.1
ATGAAGGTTTCTTGCTTCTTGCTTCTCCTGATGATTTGTTTAGCTATGATGTTGCAAGAGCATCAGCCAAGCATAGGCTACAAAGCAATGGCCTTAGTCT
TGGACCGCAGTCCTGAAATGGGTAAGGTTAAAATTGCTTCTACCAACCATTTCTCCACGGAAGTAAAGGTGGGGCAGCTAGGAAGGACATCCCGGAGGCC
AATTCCATCCCCACCTCCCCCAAAACCCAATAGATCGGTTCATTGGTGGGTCGTTACACCGCCACCACCTATACCATCGTCGCCGCCGCCCCCATCTCCA
CTATCGTCATCTAAAGGCGCATGA
AA sequence
>Potri.019G015800.1 pacid=42773515 polypeptide=Potri.019G015800.1.p locus=Potri.019G015800 ID=Potri.019G015800.1.v4.1 annot-version=v4.1
MKVSCFLLLLMICLAMMLQEHQPSIGYKAMALVLDRSPEMGKVKIASTNHFSTEVKVGQLGRTSRRPIPSPPPPKPNRSVHWWVVTPPPPIPSSPPPPSP
LSSSKGA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G015800
[exp]
0 1
AT2G01290 RPI2 ribose-5-phosphate isomerase 2... Potri.008G127600
[exp]
1.00 0.9233
AT2G28330 unknown protein Potri.016G142100
[exp]
1.41 0.8840
AT2G17220 Kin3 kinase 3, Protein kinase super... Potri.007G062700
[exp]
5.56 0.8378
AT3G07790 DGCR14-related (.1) Potri.002G222100
[exp]
6.48 0.8707
AT3G63380 ATPase E1-E2 type family prote... Potri.005G215600
[exp]
6.70 0.8802
AT3G25070 RIN4 RPM1 interacting protein 4 (.1... Potri.002G245400
[exp]
8.30 0.8838 RIN4.1
AT5G13860 ELC-LIKE, ATELC... ELCH-like (.1) Potri.001G034200
[exp]
8.83 0.8313
AT2G39380 ATEXO70H2 exocyst subunit exo70 family p... Potri.001G234600
[exp]
9.48 0.8624
AT1G06800 PLA-I{gamma}1 phospholipase A I gamma 1, alp... Potri.005G218500
[exp]
9.48 0.8661
AT5G38260 Protein kinase superfamily pro... Potri.015G045000
[exp]
12.48 0.8619

Potri.019G015800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.