Potri.019G015900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G015800 105 / 8e-31 ND /
Potri.019G016000 103 / 4e-30 ND /
Potri.019G016108 99 / 3e-28 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G015900.1 pacid=42773879 polypeptide=Potri.019G015900.1.p locus=Potri.019G015900 ID=Potri.019G015900.1.v4.1 annot-version=v4.1
ATGAAGGTTTCTTGCTTCATGCTTCTCCTGATGATGTTTTTTGCTATGACGTTGCAAGACCATCAGCCAAGCATAGGCTACAAAGCAATGGCCTTAGTCT
TGGACCGCAGTCCTGAAATGGGTAAGGTTAAAATTGCTTCTACCGACCATTTCTCCACGGAAGTAAAGGTGGGGCAGCTAGGAAGGAGATCCCGGAGGCC
AATTCCATCACCACCTCCCCCAAAACCCAATAGATTGGTTCATTGGAGGTGGGTCGTTACACCGCCACCACCTATGTCATCGTCGCCGCCGCCACCATCT
CCACTATCGTTATCTAAAGGCGCATGA
AA sequence
>Potri.019G015900.1 pacid=42773879 polypeptide=Potri.019G015900.1.p locus=Potri.019G015900 ID=Potri.019G015900.1.v4.1 annot-version=v4.1
MKVSCFMLLLMMFFAMTLQDHQPSIGYKAMALVLDRSPEMGKVKIASTDHFSTEVKVGQLGRRSRRPIPSPPPPKPNRLVHWRWVVTPPPPMSSSPPPPS
PLSLSKGA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G015900 0 1
Potri.019G016106 9.79 0.8052
Potri.019G015800 29.24 0.7531
AT2G26110 Protein of unknown function (D... Potri.006G228800 36.18 0.7390
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Potri.002G012800 48.64 0.7247 Ptr4CL20
AT2G17220 Kin3 kinase 3, Protein kinase super... Potri.007G062700 69.06 0.7112
Potri.014G071001 83.78 0.6977
AT1G13260 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING ... Potri.015G015650 98.95 0.6753
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Potri.006G172900 99.63 0.6939
AT1G36370 SHM7 serine hydroxymethyltransferas... Potri.005G170800 99.85 0.6932
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Potri.008G054700 120.00 0.6830 Pt-HSP70.6

Potri.019G015900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.