Potri.019G016108 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G015800 120 / 9e-37 ND /
Potri.019G015900 109 / 2e-32 ND /
Potri.019G016000 105 / 1e-30 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G016108.1 pacid=42774024 polypeptide=Potri.019G016108.1.p locus=Potri.019G016108 ID=Potri.019G016108.1.v4.1 annot-version=v4.1
ATGAAGGTTTCTTGCTTCTTGCTTCTCCTGGTGATTTGTTTAGCTATGATGATGCTAGACCATCAGCCAAGCACAGGCTACAAAGCAATGGCCTTAGTCT
TGGACTGCAGTCCTGAAATGGGTAAGGTTAAAATTGCTTCTACCGACCATTTCTCCACGGAAGTAAAGGTGGGGCAGCTAGGAAGGAGATCCCGGAGGGC
AATTCCATCACCACCTCCCCCAAAACCCAATAGATCGGTTCATTGGTGGGTCGTTACACCGCCACCACCTATGCCATCGTTGCCGCCGCCCCCATCTCCA
CTATCGTCATCTAAAGGCGCATGA
AA sequence
>Potri.019G016108.1 pacid=42774024 polypeptide=Potri.019G016108.1.p locus=Potri.019G016108 ID=Potri.019G016108.1.v4.1 annot-version=v4.1
MKVSCFLLLLVICLAMMMLDHQPSTGYKAMALVLDCSPEMGKVKIASTDHFSTEVKVGQLGRRSRRAIPSPPPPKPNRSVHWWVVTPPPPMPSLPPPPSP
LSSSKGA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G016108 0 1
AT1G21710 OGG1, ATOGG1 ARABIDOPSIS 8-OXOGUANINE-DNA G... Potri.005G180700 14.62 0.6110 OGG1.1
AT4G27290 S-locus lectin protein kinase ... Potri.011G129000 15.87 0.5798
AT3G59800 unknown protein Potri.007G139900 38.96 0.5510
AT2G21260 NAD(P)-linked oxidoreductase s... Potri.014G144700 98.90 0.4637 Pt-S6PDH.1
AT1G60900 U2 snRNP auxilliary factor, la... Potri.011G050400 133.64 0.4752

Potri.019G016108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.