Potri.019G017150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G017300 38 / 0.0001 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G017150.2 pacid=42773079 polypeptide=Potri.019G017150.2.p locus=Potri.019G017150 ID=Potri.019G017150.2.v4.1 annot-version=v4.1
ATGGGTGCCATTTCATCTTTACTTTGTTTCTTCTTGATCCATGTTCTGCTATTATCATCTCATAGTAGCTACATCTGCAAGGCTTTTGAATGGTCTTCTT
CTGATGCAATTTCTTCAAATGATTTTCCTAACTACAAGGTGGGGGTATTGAGAAGGTCAATACCATCGCCACCACCTCCCAGGGTCAATCCTCCTCTTCA
TTCCATCCGTCCTTCTCCTCGGGCACCGCCGCCTCCACCGTATTGA
AA sequence
>Potri.019G017150.2 pacid=42773079 polypeptide=Potri.019G017150.2.p locus=Potri.019G017150 ID=Potri.019G017150.2.v4.1 annot-version=v4.1
MGAISSLLCFFLIHVLLLSSHSSYICKAFEWSSSDAISSNDFPNYKVGVLRRSIPSPPPPRVNPPLHSIRPSPRAPPPPPY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G017150 0 1
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.011G110100 3.74 0.8391
AT3G54320 AP2_ERF ATWRI1, ASML1, ... WRINKLED 1, WRINKLED, ACTIVATO... Potri.010G247200 3.87 0.8508
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.011G110400 4.24 0.8338
AT1G21740 Protein of unknown function (D... Potri.004G177200 11.18 0.8436
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Potri.008G054801 12.24 0.7887
AT1G65620 AS2 AS2 ASYMMETRIC LEAVES 2, Lateral o... Potri.008G079800 12.52 0.8544 Pt-AS2.2
AT5G07440 GDH2 glutamate dehydrogenase 2 (.1.... Potri.015G111000 16.00 0.8454
AT2G44930 Plant protein of unknown funct... Potri.014G054100 19.05 0.8335
AT1G29670 GDSL-like Lipase/Acylhydrolase... Potri.012G137550 20.49 0.8421
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.016G022250 30.06 0.8372

Potri.019G017150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.