Potri.019G017302 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G017600 53 / 2e-10 ND /
Potri.019G017850 53 / 3e-10 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G017302.1 pacid=42774650 polypeptide=Potri.019G017302.1.p locus=Potri.019G017302 ID=Potri.019G017302.1.v4.1 annot-version=v4.1
ATGGAAATCTACTCCTACTTGTTGGCATTCATCATTTTTCATGGGATGATACTATCACAAACCAGTTGCATGCTTAATGCCATATCAGTTAAAATTAAAC
TTCCGCCAATACCACGTCGACCACCACGTCTACCACCACTACCGCCACTACCACGTCGACGACCACGTCGACCATCACCACGACCACCACCACCATCAAA
AGTACTCAATGATGGCCTTCATACTAGTCTTCCTCCACCACAAAAAATATTACCACCACCACACACCTATGGTAGCCCTCGTTACCCTCCAAGTCCACCA
CCACAACGTAGTTAA
AA sequence
>Potri.019G017302.1 pacid=42774650 polypeptide=Potri.019G017302.1.p locus=Potri.019G017302 ID=Potri.019G017302.1.v4.1 annot-version=v4.1
MEIYSYLLAFIIFHGMILSQTSCMLNAISVKIKLPPIPRRPPRLPPLPPLPRRRPRRPSPRPPPPSKVLNDGLHTSLPPPQKILPPPHTYGSPRYPPSPP
PQRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G017302 0 1
Potri.006G021800 2.44 0.9249
AT3G62020 GLP10 germin-like protein 10 (.1.2) Potri.010G240600 3.00 0.9180 Pt-GER2.19
AT3G04200 RmlC-like cupins superfamily p... Potri.010G240500 4.47 0.9157
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Potri.004G132500 4.89 0.8940 LCOSC2.4
AT1G10040 alpha/beta-Hydrolases superfam... Potri.002G113000 4.89 0.8641
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Potri.001G335200 5.00 0.8959
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.011G137800 6.00 0.8072
AT2G23140 RING/U-box superfamily protein... Potri.006G251000 6.32 0.8320
AT1G20823 RING/U-box superfamily protein... Potri.008G054200 8.83 0.7985
AT5G19650 OFP ATOFP8, OFP8 ovate family protein 8 (.1) Potri.002G262500 9.94 0.8084

Potri.019G017302 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.