Potri.019G017304 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G017600 54 / 9e-11 ND /
Potri.019G017850 47 / 4e-08 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G017304.1 pacid=42774557 polypeptide=Potri.019G017304.1.p locus=Potri.019G017304 ID=Potri.019G017304.1.v4.1 annot-version=v4.1
ATGATACTATCACAAACCAGTTGCATGGTTAATGCCTCGTTACAACGACGTCGAACACCACCACCACCATCTCCAAAAAACATCGTATTATTCATCCGAT
ATTACCACCATTTAAGCCTATTCCAAAATCTCCTCCTCCTCCTCCAAGACCACCACCACCAAAAGTCAATGATGCCGGTCATCCTAGTCTTCCTCCACCA
CCAAAAATATTACCACCACCACACACCTATAGTAGCCCTCGTTACCCTCCACCACCACAACGTAGTTAATAACATCAAAGTTGCCTCCACCTTCATCGCA
GTATACTTGGCTCTCCTTCCTCAAAAATAA
AA sequence
>Potri.019G017304.1 pacid=42774557 polypeptide=Potri.019G017304.1.p locus=Potri.019G017304 ID=Potri.019G017304.1.v4.1 annot-version=v4.1
MILSQTSCMVNASLQRRRTPPPPSPKNIVLFIRYYHHLSLFQNLLLLLQDHHHQKSMMPVILVFLHHQKYYHHHTPIVALVTLHHHNVVNNIKVASTFIA
VYLALLPQK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G017304 0 1
AT4G37290 unknown protein Potri.005G142900 1.41 0.9874
Potri.008G019250 3.00 0.9742
AT5G14930 GENE101, SAG101 senescence-associated gene 101... Potri.019G007227 3.46 0.9675
AT4G37980 ELI3-1, ATCAD7 CINNAMYL-ALCOHOL DEHYDROGENASE... Potri.001G268600 4.89 0.9704 CADL9,CAD.6
AT1G21550 Calcium-binding EF-hand family... Potri.005G183300 5.00 0.9684
Potri.011G081701 5.65 0.9654
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Potri.009G098966 7.00 0.9658
Potri.014G066850 8.83 0.9082
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Potri.004G024404 9.79 0.9474
AT3G53150 UGT73D1 UDP-glucosyl transferase 73D1 ... Potri.006G120600 10.09 0.9465 GT4.2

Potri.019G017304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.