Potri.019G017850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G017600 54 / 9e-11 ND /
Potri.019G017302 53 / 2e-10 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G017850.1 pacid=42773435 polypeptide=Potri.019G017850.1.p locus=Potri.019G017850 ID=Potri.019G017850.1.v4.1 annot-version=v4.1
ATGGAAATCTATTCCTACTTGTTGGCATTCATCATTTTTCATGGGATGTTAGTATCACAAACCAGTTGCATGGTTAATGTCTCGTTACAACGTCGACGAC
CATTACCACCACCACCACCACCATCACCACCACCACCCAATCAAAGTATTCATCCAAAGCCAAAACCACCAACAATTAAGCCTTATTTTCCAAAATCTCC
TCCTCCTCCTCCACGAACACCAGCACCACCAAAAGTCAATGATGGCCATCATCCTAGTCTTCCTCCACCACCACCACATACCTATGGTAGCCCTCGTTAC
CCTCCACCACCACAACGTAGTTAA
AA sequence
>Potri.019G017850.1 pacid=42773435 polypeptide=Potri.019G017850.1.p locus=Potri.019G017850 ID=Potri.019G017850.1.v4.1 annot-version=v4.1
MEIYSYLLAFIIFHGMLVSQTSCMVNVSLQRRRPLPPPPPPSPPPPNQSIHPKPKPPTIKPYFPKSPPPPPRTPAPPKVNDGHHPSLPPPPPHTYGSPRY
PPPPQRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G017850 0 1
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Potri.011G027501 3.46 0.9418
Potri.012G124666 6.32 0.9430
Potri.019G017600 7.74 0.9553
AT5G26170 WRKY ATWRKY50, WRKY5... ARABIDOPSIS THALIANA WRKY DNA-... Potri.006G224100 11.57 0.9532
AT1G62300 WRKY ATWRKY6, WRKY6 WRKY family transcription fact... Potri.011G007800 15.74 0.9452 Pt-WRKY42.1
AT5G13080 WRKY ATWRKY75, WRKY7... ARABIDOPSIS THALIANA WRKY DNA-... Potri.003G169100 20.90 0.9295
AT1G30760 FAD-binding Berberine family p... Potri.001G462700 22.60 0.9412
AT5G51160 Ankyrin repeat family protein ... Potri.006G223800 23.32 0.9300
AT2G29460 GST22, ATGSTU4 GLUTATHIONE S-TRANSFERASE 22, ... Potri.015G042000 24.89 0.9293
AT2G31880 SOBIR1, EVR SUPPRESSOR OF BIR1 1, EVERSHED... Potri.012G090500 27.20 0.9364

Potri.019G017850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.