Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04500 321 / 6e-112 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G17370 78 / 2e-16 UBP1B oligouridylate binding protein 1B (.1.2) AT1G54080 77 / 3e-16 UBP1A oligouridylate-binding protein 1A (.1.2) AT3G14100 77 / 4e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G19130 74 / 5e-15 ATRBP47B RNA-binding protein 47B (.1) AT5G54900 73 / 1e-14 ATRBP45A RNA-binding protein 45A (.1) AT4G27000 72 / 1e-14 ATRBP45C RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G11650 71 / 2e-14 ATRBP45B RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G49600 71 / 8e-14 ATRBP47A RNA-binding protein 47A (.1) AT1G47490 69 / 1e-13 ATRBP47C RNA-binding protein 47C (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G046900 [exp] 379 / 7e-135 AT3G04500 291 / 4e-100 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G279600 [exp] 81 / 1e-17 AT1G17370 469 / 9e-165 oligouridylate binding protein 1B (.1.2) Potri.018G002300 [exp] 80 / 5e-17 AT1G17370 461 / 1e-161 oligouridylate binding protein 1B (.1.2) Potri.006G139300 [exp] 78 / 1e-16 AT1G17370 580 / 0.0 oligouridylate binding protein 1B (.1.2) Potri.003G069000 [exp] 77 / 4e-16 AT1G17370 621 / 0.0 oligouridylate binding protein 1B (.1.2) Potri.001G166100 [exp] 77 / 5e-16 AT1G17370 622 / 0.0 oligouridylate binding protein 1B (.1.2) Potri.014G034600 [exp] 77 / 6e-16 AT1G47490 439 / 2e-152 RNA-binding protein 47C (.1.2) Potri.011G138400 [exp] 76 / 1e-15 AT4G27000 463 / 1e-162 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G423400 [exp] 75 / 2e-15 AT4G27000 474 / 2e-166 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000555 [exp] 345 / 5e-121 AT3G04500 329 / 8e-115 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014659 [exp] 331 / 2e-115 AT3G04500 315 / 7e-109 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10041109 [exp] 83 / 3e-18 AT1G17370 378 / 3e-129 oligouridylate binding protein 1B (.1.2) Lus10027641 [exp] 81 / 1e-17 AT1G17370 569 / 0.0 oligouridylate binding protein 1B (.1.2) Lus10011924 [exp] 81 / 2e-17 AT1G17370 578 / 0.0 oligouridylate binding protein 1B (.1.2) Lus10036435 [exp] 80 / 6e-17 AT4G38670 417 / 7e-139 Pathogenesis-related thaumatin superfamily protein (.1.2.3) Lus10027911 [exp] 76 / 6e-16 AT1G49600 411 / 3e-143 RNA-binding protein 47A (.1) Lus10012071 [exp] 76 / 8e-16 AT1G49600 442 / 2e-155 RNA-binding protein 47A (.1) Lus10008130 [exp] 76 / 1e-15 AT1G17370 664 / 0.0 oligouridylate binding protein 1B (.1.2) Lus10012070 [exp] 76 / 1e-15 AT1G49600 470 / 5e-165 RNA-binding protein 47A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.019G018900.1 pacid=42774437 polypeptide=Potri.019G018900.1.p locus=Potri.019G018900 ID=Potri.019G018900.1.v4.1 annot-version=v4.1 ATGTCGATCCCTCCATCTTCTTCAACATCGCAGCAATTCACTTACGCAGCATCGACGTCAGCAACAGTAGCAAACGGCGCGTATTTCCCTACCCCATTTC ACCTCCAGCAATCGGAAACTTACCCCAAACCCTATGTCGCTCCACCTCCTACCGTCATGGCGCCCGTTTATCCGCCTGCCCCGATTGGACCCGTTTACTC CCTTCCACAGTACCAACAGGCGCACCAGTTGTTTCAGAGGGATGCACAAACGATCACGCCTGAAGCACTTGAGAGTGTGAAAGCAGCCCTTGCAAATAGT GAGGTTGAACATAAAGCAGAGACTAAAAGGAAAGCAATTCCTCGTAAAGCTGCTGGCCAGACATGGGAGGATCCAGTTCTTGCAGAATGGCCTGAAAATG ACTACCGTGTATTTTGTGGTGATCTTGGTAACGAGGTGAATGATGATGTTCTTTCAAAAGCATTTTCAAGGTTTCCTTCTTTTAACTTGGCCAGAGTTGT CAGGGATAAGCGAACTGGAAAGACCAAGGGCTATGGATTTGTTAGCTTTGCCAACCCTACTGACCTTGCTGCTGCACTTAAGGAGATGAATGGTAAATAT GTCGGAAACCGGCCTATCAAATTACGGAAGAGCAACTGGAGGGAGAGGACAGATTACGGAGCTTTAGAAAGACAAAAGAACCAGAGTCAAAGGAAACCGA AGCTTCCAAAGAAGAGTGTATTGCACAAGTAA
AA sequence Show only first row Show all	>Potri.019G018900.1 pacid=42774437 polypeptide=Potri.019G018900.1.p locus=Potri.019G018900 ID=Potri.019G018900.1.v4.1 annot-version=v4.1 MSIPPSSSTSQQFTYAASTSATVANGAYFPTPFHLQQSETYPKPYVAPPPTVMAPVYPPAPIGPVYSLPQYQQAHQLFQRDAQTITPEALESVKAALANS EVEHKAETKRKAIPRKAAGQTWEDPVLAEWPENDYRVFCGDLGNEVNDDVLSKAFSRFPSFNLARVVRDKRTGKTKGYGFVSFANPTDLAAALKEMNGKY VGNRPIKLRKSNWRERTDYGALERQKNQSQRKPKLPKKSVLHK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04500			RNA-binding (RRM/RBD/RNP motif...		Potri.019G018900 [exp]	0	1
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Potri.001G033800 [exp]	2.00	0.9217
					Potri.017G044550 [exp]	2.82	0.9195
AT4G08850			Leucine-rich repeat receptor-l...		Potri.002G008375 [exp]	10.00	0.9086
AT3G22930		CML11	calmodulin-like 11 (.1)		Potri.002G047300 [exp]	11.35	0.9393	Pt-ACCAL.7
AT4G19950			unknown protein		Potri.007G105600 [exp]	13.82	0.8447	Pt-ORF.7
AT3G02860	C2H2ZnF		zinc ion binding (.1.2)		Potri.017G135500 [exp]	15.23	0.9266
AT4G01200			Calcium-dependent lipid-bindin...		Potri.002G166400 [exp]	20.49	0.8938
AT5G43150			unknown protein		Potri.002G119700 [exp]	21.54	0.8221
AT5G41990		EIP1, ATWNK8, W...	EMF1-Interacting Protein 1, wi...		Potri.001G085500 [exp]	21.81	0.8189	WNK8.2
AT5G53000		TAP46	2A phosphatase associated prot...		Potri.012G016500 [exp]	23.23	0.9067

Compare expression of checked genes

Potri.019G018900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.