Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 153 / 2e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 108 / 3e-26 transmembrane receptors;ATP binding (.1.2) AT3G44480 108 / 4e-26 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G69550 107 / 1e-25 disease resistance protein (TIR-NBS-LRR class) (.1) AT5G40060 106 / 2e-25 Disease resistance protein (NBS-LRR class) family (.1) AT4G19500 100 / 2e-23 nucleoside-triphosphatases;transmembrane receptors;nucleotide binding;ATP binding (.1.2) AT5G44870 100 / 2e-23 TTR1, LAZ5 tolerance to Tobacco ringspot virus 1, LAZARUS 5, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G38340 97 / 3e-22 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17880 97 / 3e-22 CSA1 constitutive shade-avoidance1, disease resistance protein (TIR-NBS-LRR class) (.1) AT1G31540 97 / 3e-22 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T001500 [exp] 421 / 3e-139 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 418 / 7e-138 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G016425 [exp] 414 / 4e-136 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G014200 [exp] 410 / 6e-135 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 406 / 4e-134 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 398 / 5e-132 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G052000 [exp] 401 / 5e-131 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002066 [exp] 388 / 1e-126 AT5G36930 631 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 375 / 3e-123 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 139 / 1e-36 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10011741 [exp] 129 / 4e-33 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10033825 [exp] 127 / 2e-32 AT5G36930 400 / 3e-123 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 125 / 7e-32 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10030839 [exp] 125 / 1e-31 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10018616 [exp] 124 / 4e-31 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10019708 [exp] 119 / 1e-29 AT5G17680 495 / 1e-150 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011104 [exp] 118 / 3e-29 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 107 / 1e-25 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10003749 [exp] 103 / 4e-24 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF00560 [poplar] [flax] LRR_1 Leucine Rich Repeat CL0022 [poplar] [flax] LRR PF07725 [poplar] [flax] LRR_3 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Potri.019G021024.1 pacid=42773091 polypeptide=Potri.019G021024.1.p locus=Potri.019G021024 ID=Potri.019G021024.1.v4.1 annot-version=v4.1 ATGTTTAAATTTACTCCAAATCAATGGAGTACATCTCACCGGACCTTCAAACTGCTTTCTAAAGAGTTGATGTGGATTTGTTGGCTTCAATGTCCTTTGA AATATTTTCCATCTGATTTTACCTTGGACAATCTAGTTGTTCTTGATATGCAGTATAGTAACCTCAAAGAACTATGGAAGGGAAAAAAGATTCTCAACAG GCTAAAAATCATTAATCTCAGTCATTCTCAGCATCTTATTAAAACACCAAACTTGCATAGTTCAAGTATAGAGAAACTAATTCTGAAAGGTTGCTCGAGT TTAGTTGAGGTGAATCAATCTATTGAAAATTTGACGAGCGTTGTTTTCTTGAATCTGGAGGGATGTTGGAGGCTAAAGATTCTCCCTGAAAGCATTGGCA ATGTAAAGTCTCTTAAACGTTTGAATATTTCTGGGTGTTCTCAACTTGAGAAATTGCCAGAACGCATGGGTGATATGAAATCCTTAACTGAGCTGCTAGC CGATGGGATTGAAAATGAGCAATTTCTCTCTTCAATTGGACAATTAAAGTATGTCAGAAGATTATCATTGCGTGGATACAGTTTTAGCCAGGACTCACCA TCATGGCTTTCACCGTCATCTACATCTTGGCCTCCATCAATTTCTTCTTTTATTTCAGCAAGTGTTTTATGTTTGAAACGTTTGCTACCAACAACTTTCA TCGATTGGAGATCAGTGAAAAGTCTTGAACTTCCTTATGTTGGTTTGTCTGATCAAGCAACTTACTGTGTTGATTTTAGGGGTTTTTCCTCTCTAGAAGA ACTGGATCTATCAGGAAACAAATTCTCTAGCCTGCCTTCTGGGATCGGCTTCCTTCCCAAGCTAAGGGTCTTGTTTGTCACAGATGCAAATATCTTGTAT CAATCCCAGATGTTCCCTCAAGTTTAA
AA sequence Show only first row Show all	>Potri.019G021024.1 pacid=42773091 polypeptide=Potri.019G021024.1.p locus=Potri.019G021024 ID=Potri.019G021024.1.v4.1 annot-version=v4.1 MFKFTPNQWSTSHRTFKLLSKELMWICWLQCPLKYFPSDFTLDNLVVLDMQYSNLKELWKGKKILNRLKIINLSHSQHLIKTPNLHSSSIEKLILKGCSS LVEVNQSIENLTSVVFLNLEGCWRLKILPESIGNVKSLKRLNISGCSQLEKLPERMGDMKSLTELLADGIENEQFLSSIGQLKYVRRLSLRGYSFSQDSP SWLSPSSTSWPPSISSFISASVLCLKRLLPTTFIDWRSVKSLELPYVGLSDQATYCVDFRGFSSLEELDLSGNKFSSLPSGIGFLPKLRVLFVTDANILY QSQMFPQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.019G021024 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.019G017082 [exp]	1.00	0.9621
AT5G36930			Disease resistance protein (TI...		Potri.006G283600 [exp]	1.41	0.9613
AT3G14470			NB-ARC domain-containing disea...		Potri.003G200080 [exp]	3.46	0.9579
AT3G14460			LRR and NB-ARC domains-contain...		Potri.017G015000 [exp]	4.00	0.9469
AT3G14470			NB-ARC domain-containing disea...		Potri.003G200500 [exp]	6.00	0.9451
AT5G36930			Disease resistance protein (TI...		Potri.011G009400 [exp]	6.32	0.9412
AT5G36930			Disease resistance protein (TI...		Potri.019G052000 [exp]	8.06	0.9371
AT3G14470			NB-ARC domain-containing disea...		Potri.017G127651 [exp]	8.48	0.9378
AT5G36930			Disease resistance protein (TI...		Potri.019G018396 [exp]	9.21	0.9178
AT4G02550			unknown protein		Potri.009G022650 [exp]	10.58	0.9232

Compare expression of checked genes

Potri.019G021024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.