Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23960 46 / 2e-07 ATTPS21 terpene synthase 21 (.1.2) AT4G13300 37 / 0.0005 ATTPS13, TPS13 terpenoid synthase 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G016900 [exp] 121 / 3e-34 AT5G23960 474 / 6e-163 terpene synthase 21 (.1.2) Potri.019G045100 [exp] 120 / 1e-33 AT5G23960 474 / 2e-162 terpene synthase 21 (.1.2) Potri.019G023004 [exp] 110 / 5e-30 AT5G23960 474 / 8e-163 terpene synthase 21 (.1.2) Potri.019G045400 [exp] 108 / 1e-29 AT5G23960 368 / 8e-123 terpene synthase 21 (.1.2) Potri.019G020367 [exp] 108 / 2e-29 AT5G23960 494 / 7e-171 terpene synthase 21 (.1.2) Potri.019G016122 [exp] 107 / 6e-29 AT5G23960 426 / 7e-144 terpene synthase 21 (.1.2) Potri.019G016118 [exp] 103 / 6e-29 AT5G23960 197 / 1e-59 terpene synthase 21 (.1.2) Potri.019G016500 [exp] 105 / 3e-28 AT5G23960 463 / 6e-159 terpene synthase 21 (.1.2) Potri.019G044900 [exp] 103 / 9e-28 AT5G23960 342 / 8e-112 terpene synthase 21 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002660 [exp] 39 / 8e-05 AT3G14520 310 / 4e-98 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10031590 [exp] 37 / 0.0003 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G023002.1 pacid=42774007 polypeptide=Potri.019G023002.1.p locus=Potri.019G023002 ID=Potri.019G023002.1.v4.1 annot-version=v4.1 ATGGAAGAGATACAAAAGATGGTCGTAAATGGATGGAAGGACATCAATGAAGATTGCGTGAGGCCACCTAATGCTTCAATGCTTCTCCTTCGACATATTG TAAACCTTGCTCGAGTTACCGATGTTATGTATGGGGATGACGCCGACGCCTACACAATCCCATTAAGTTTAAAAGATTATGTCACTTTATTATATGACAG CAGTTATACACTCCTCTAA
AA sequence Show only first row Show all	>Potri.019G023002.1 pacid=42774007 polypeptide=Potri.019G023002.1.p locus=Potri.019G023002 ID=Potri.019G023002.1.v4.1 annot-version=v4.1 MEEIQKMVVNGWKDINEDCVRPPNASMLLLRHIVNLARVTDVMYGDDADAYTIPLSLKDYVTLLYDSSYTLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G023002 [exp]	0	1
AT2G27500			Glycosyl hydrolase superfamily...		Potri.004G097400 [exp]	6.00	0.6659
AT1G50200		ACD, ALATS	Alanyl-tRNA synthetase (.1.2)		Potri.007G070250 [exp]	14.83	0.6301
AT1G16930			F-box/RNI-like/FBD-like domain...		Potri.011G121400 [exp]	18.13	0.5677
AT1G49330			hydroxyproline-rich glycoprote...		Potri.009G113900 [exp]	20.34	0.6815
AT5G47530			Auxin-responsive family protei...		Potri.019G096600 [exp]	20.73	0.6643
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Potri.007G105200 [exp]	23.45	0.5962
AT5G15110			Pectate lyase family protein (...		Potri.008G148800 [exp]	30.82	0.6066
AT1G21750		ATPDI5, ATPDIL1...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.005G179000 [exp]	31.01	0.6272	Pt-PDI.2
					Potri.018G058450 [exp]	35.49	0.5709
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Potri.008G125300 [exp]	42.49	0.5695	CYP96.3

Compare expression of checked genes

Potri.019G023002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.