Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16740 115 / 2e-30 ATTPS03 terpene synthase 03 (.1.2) AT2G24210 108 / 2e-27 AtTPS10 terpene synthase 10 (.1) AT3G25820 99 / 5e-24 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2) AT3G25830 99 / 8e-24 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) AT4G16730 95 / 1e-22 AtTPS02 terpene synthase 02 (.1) AT3G25810 95 / 1e-22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT5G23960 76 / 6e-16 ATTPS21 terpene synthase 21 (.1.2) AT1G61680 73 / 6e-15 ATTPS14 terpene synthase 14 (.1.2) AT3G29110 66 / 2e-12 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G70080 65 / 3e-12 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G023014 [exp] 387 / 2e-136 AT4G16740 294 / 1e-96 terpene synthase 03 (.1.2) Potri.019G023006 [exp] 392 / 7e-136 AT3G25830 540 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G022338 [exp] 323 / 1e-108 AT3G25830 483 / 8e-165 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023008 [exp] 308 / 3e-103 AT3G25830 535 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023000 [exp] 267 / 1e-88 AT4G16740 208 / 8e-63 terpene synthase 03 (.1.2) Potri.019G046201 [exp] 184 / 1e-59 AT4G16730 107 / 1e-27 terpene synthase 02 (.1) Potri.001G308300 [exp] 183 / 7e-55 AT3G25830 507 / 4e-174 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308200 [exp] 183 / 8e-55 AT3G25810 499 / 4e-171 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.017G041700 [exp] 115 / 5e-30 AT3G25810 432 / 3e-145 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007624 [exp] 100 / 1e-24 AT4G16740 334 / 8e-108 terpene synthase 03 (.1.2) Lus10008614 [exp] 95 / 2e-22 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2) Lus10008611 [exp] 90 / 9e-21 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2) Lus10018501 [exp] 89 / 2e-20 AT4G16740 413 / 1e-137 terpene synthase 03 (.1.2) Lus10031590 [exp] 88 / 4e-20 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2) Lus10042204 [exp] 86 / 3e-19 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2) Lus10014724 [exp] 84 / 6e-19 AT5G23960 314 / 2e-100 terpene synthase 21 (.1.2) Lus10039713 [exp] 84 / 8e-19 AT4G16740 409 / 4e-136 terpene synthase 03 (.1.2) Lus10033643 [exp] 84 / 1e-18 AT4G16730 356 / 2e-115 terpene synthase 02 (.1) Lus10025922 [exp] 82 / 4e-18 AT3G25810 353 / 3e-114 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01397 [poplar] [flax] Terpene_synth Terpene synthase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.019G023018.1 pacid=42773493 polypeptide=Potri.019G023018.1.p locus=Potri.019G023018 ID=Potri.019G023018.1.v4.1 annot-version=v4.1 ATGGCTCTTACCCACTTTGCTTCATCATTTTGTACTCTCCCAACATTAGCATCTCCAAGTCGCGCCTTAGCAGGACCTGTATCAAGCAAGAATTATCGCT CTCTACCTACCAAAGTTCGATGCATGGTTGCCACCGAAGCTGCTGGTCAAATTGTCCGGCGGTCGGCAAATTATCAAACTTCCATATGGGAGTATGATTT TGTTCAGTCACTGACTAGTAAATATAAGGGAGAGCCATATACAGCGCGAAGCGAAAAGTTGAAGGCAAACATAAGGATGATGCTGGCGAACGCATCGAAA CCCTTGGATCAACTTGAGCTAATCGATGCCTTGCAAAGACTGGGGTTATCTTACCATTTTGTTGATGAAATAAAGAGCACGTTGAAGAGTTTATTCTATA AAAATCATGTAGAGAATACAAAGACAGTACATGACTTGTATGCTACTGCTCTAGAATTTCGACTCCTAAGGCAGCATGGATACAAGGTACCTCAAGAGGT TTTCAATCATTTCAAGGACGAACAAGGAAACTTTAGGGCATGGATTCATGAAGATTTGAAGGGAATAGCTACTTCTGTAGAGGAGCTCTGTATGAAGCTT CATACTTCTTGGTAG
AA sequence Show only first row Show all	>Potri.019G023018.1 pacid=42773493 polypeptide=Potri.019G023018.1.p locus=Potri.019G023018 ID=Potri.019G023018.1.v4.1 annot-version=v4.1 MALTHFASSFCTLPTLASPSRALAGPVSSKNYRSLPTKVRCMVATEAAGQIVRRSANYQTSIWEYDFVQSLTSKYKGEPYTARSEKLKANIRMMLANASK PLDQLELIDALQRLGLSYHFVDEIKSTLKSLFYKNHVENTKTVHDLYATALEFRLLRQHGYKVPQEVFNHFKDEQGNFRAWIHEDLKGIATSVEELCMKL HTSW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Potri.019G023018 [exp]	0	1
AT1G29720			Leucine-rich repeat transmembr...		Potri.011G072641 [exp]	1.00	0.8926
AT4G22880		TT18, TDS4, ANS...	TANNIN DEFICIENT SEED 4, ANTHO...		Potri.001G113100 [exp]	5.47	0.8541	Pt-ANS.1
AT4G27310	CO		B-box type zinc finger family ...		Potri.004G026900 [exp]	6.48	0.7107
					Potri.012G134250 [exp]	6.92	0.6544
AT5G17220		GST26, TT19, AT...	TRANSPARENT TESTA 19, GLUTATHI...		Potri.017G138800 [exp]	14.69	0.7645	ATGSTF10.1
AT5G49330	MYB	PFG3, ATMYB111	PRODUCTION OF FLAVONOL GLYCOSI...		Potri.001G086700 [exp]	17.60	0.7540
AT1G64320			myosin heavy chain-related (.1...		Potri.003G137300 [exp]	23.02	0.7261
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Potri.007G021300 [exp]	23.23	0.7133
					Potri.003G189601 [exp]	26.38	0.7233
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Potri.010G179900 [exp]	30.72	0.7147

Compare expression of checked genes

Potri.019G023018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.