PtrcPrxIIF,Pt-PRX.1 (Potri.019G024000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PtrcPrxIIF,Pt-PRX.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06050 311 / 2e-109 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
AT1G60740 107 / 1e-29 Thioredoxin superfamily protein (.1)
AT1G65970 104 / 2e-28 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G65980 103 / 4e-28 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT3G52960 102 / 5e-27 Thioredoxin superfamily protein (.1)
AT1G65990 67 / 4e-13 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G102100 105 / 4e-28 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.001G423500 102 / 2e-27 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.018G083500 101 / 4e-27 AT1G65980 280 / 4e-98 thioredoxin-dependent peroxidase 1 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021932 327 / 2e-114 AT3G06050 317 / 6e-111 peroxiredoxin IIF (.1)
Lus10041218 251 / 1e-82 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
Lus10023180 101 / 4e-27 AT1G65980 268 / 2e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10015077 100 / 2e-26 AT1G65980 268 / 3e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10002843 100 / 3e-26 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10023662 99 / 3e-26 AT1G65980 264 / 5e-92 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10003373 100 / 1e-25 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Potri.019G024000.1 pacid=42773575 polypeptide=Potri.019G024000.1.p locus=Potri.019G024000 ID=Potri.019G024000.1.v4.1 annot-version=v4.1
ATGGCATCTGCAATCCTCAAGCGAACAAGCCCTTCTTGCCTCCTCAAGTCAATGGCTGATAGTCTCGGAATCATCGGAGGATCGTGGAGATCCTACGCTA
AGGTTGCAGTCGGGACTGACATAGTCTCCGCTGCACCCGGCGTTTCCCTCCAAAAATCCCGGACCTGGGACGAAGGTGTTTCTTCAAAATTCTCAACAAC
TCCATTAAAAGACATTTTCAAGGGCAAAAAAGTTGTCATCTTCGGCCTCCCTGGAGCATACACAGGGGTTTGTTCACAGCAGCATGTGCCTAGTTACAAA
AATATAATTGATAAGTTCAAGGCTAAAGGGATTGATTCTGTCATTTGTGTGGCTGTTAACGATCCATATACTATGAATGCTTGGGCAGAGAAACTTCAAG
CTAAAGATGCTATTGAATTTTACGGAGACTTTGATGGGAGCCTTCACAAGAGCTTGGAATTAAATAAAGATCTCTCCGTTGCTTTGCTAGGGCATCGCTC
TGAAAGATGGTCTGCTTATGTGGAAGATGGAATGGTGAAGGTTCTAAATGTAGAGGAAGCTCCATCCGACTTCAAGGTTTCCAGCGGCGAAGTCATACTG
GGACAAATCTAA
AA sequence
>Potri.019G024000.1 pacid=42773575 polypeptide=Potri.019G024000.1.p locus=Potri.019G024000 ID=Potri.019G024000.1.v4.1 annot-version=v4.1
MASAILKRTSPSCLLKSMADSLGIIGGSWRSYAKVAVGTDIVSAAPGVSLQKSRTWDEGVSSKFSTTPLKDIFKGKKVVIFGLPGAYTGVCSQQHVPSYK
NIIDKFKAKGIDSVICVAVNDPYTMNAWAEKLQAKDAIEFYGDFDGSLHKSLELNKDLSVALLGHRSERWSAYVEDGMVKVLNVEEAPSDFKVSSGEVIL
GQI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G06050 PRXIIF, ATPRXII... peroxiredoxin IIF (.1) Potri.019G024000 0 1 PtrcPrxIIF,Pt-PRX.1
AT2G41530 ATSFGH ARABIDOPSIS THALIANA S-FORMYLG... Potri.006G047000 5.19 0.8883
AT4G17600 LIL3:1 Chlorophyll A-B binding family... Potri.003G083500 5.65 0.9130 LIL3.2,Lil3_2
AT5G53280 PDV1 plastid division1 (.1) Potri.015G022900 8.36 0.8859
AT1G07780 TRP6, PAI1 TRANSIENT RECEPTOR POTENTIAL 6... Potri.012G145600 9.89 0.8977
AT4G25550 Cleavage/polyadenylation speci... Potri.015G143300 10.48 0.8614
AT3G53470 unknown protein Potri.016G084000 12.04 0.9194
AT5G03080 Phosphatidic acid phosphatase ... Potri.006G130700 13.03 0.8483
AT2G15290 ATTIC21, TIC21,... PERMEASE IN CHLOROPLASTS 1, CH... Potri.009G096300 15.16 0.8607
AT5G45410 unknown protein Potri.001G131300 17.94 0.8898
AT5G02120 PDE335, OHP PIGMENT DEFECTIVE 335, one hel... Potri.006G088200 18.16 0.9160

Potri.019G024000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.