Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26594 120 / 4e-36 ARR24 response regulator 24 (.1) AT3G04280 119 / 3e-35 ARR22 response regulator 22 (.1.2.3) AT2G47430 57 / 3e-10 CKI1 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) AT5G10720 52 / 1e-08 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) AT2G01830 51 / 4e-08 CRE1, AHK4, WOL1, WOL, ATCRE1 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) AT3G04580 47 / 1e-06 EIN4 ETHYLENE INSENSITIVE 4, Signal transduction histidine kinase, hybrid-type, ethylene sensor (.1.2) AT5G35750 46 / 2e-06 AHK2 histidine kinase 2 (.1) AT2G17820 44 / 6e-06 AHK1, ATHK1 histidine kinase 1 (.1) AT1G27320 44 / 1e-05 AHK3 histidine kinase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G025000 [exp] 191 / 4e-64 AT5G26594 117 / 2e-34 response regulator 24 (.1) Potri.009G108000 [exp] 130 / 5e-40 AT5G26594 163 / 5e-53 response regulator 24 (.1) Potri.002G253000 [exp] 124 / 3e-37 AT5G26594 171 / 5e-56 response regulator 24 (.1) Potri.003G177400 [exp] 126 / 7e-37 AT3G04280 99 / 9e-26 response regulator 22 (.1.2.3) Potri.003G177300 [exp] 124 / 2e-36 AT3G04280 96 / 8e-25 response regulator 22 (.1.2.3) Potri.001G055500 [exp] 117 / 2e-32 AT5G26594 80 / 6e-18 response regulator 24 (.1) Potri.001G055600 [exp] 107 / 2e-29 AT5G26594 72 / 7e-16 response regulator 24 (.1) Potri.001G050800 [exp] 100 / 5e-27 AT5G26594 77 / 4e-18 response regulator 24 (.1) Potri.003G172750 [exp] 96 / 1e-26 AT3G04280 80 / 1e-20 response regulator 22 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004775 [exp] 112 / 4e-33 AT5G26594 98 / 2e-27 response regulator 24 (.1) Lus10005407 [exp] 95 / 1e-25 AT5G26594 135 / 2e-41 response regulator 24 (.1) Lus10028021 [exp] 76 / 2e-18 AT5G26594 99 / 3e-27 response regulator 24 (.1) Lus10031600 [exp] 66 / 2e-13 AT2G47430 624 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10033746 [exp] 63 / 2e-12 AT2G47430 615 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10035114 [exp] 57 / 2e-10 AT2G47430 132 / 2e-34 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10031985 [exp] 57 / 4e-10 AT5G63890 752 / 0.0 HISTIDINE BIOSYNTHESIS 8, histidinol dehydrogenase (.1.2) Lus10029849 [exp] 55 / 2e-09 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10028992 [exp] 54 / 3e-09 AT2G01830 1337 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Lus10003686 [exp] 53 / 7e-09 AT2G01830 1330 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [poplar] [flax] CheY PF00072 [poplar] [flax] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Potri.019G024900.1 pacid=42774214 polypeptide=Potri.019G024900.1.p locus=Potri.019G024900 ID=Potri.019G024900.1.v4.1 annot-version=v4.1 ATGGCTGGTGGAGAAGAGAACAATAATGGTGGTAAAAATAGTTTTTCTGTGCTTGTTGTCGATGATGATACTATCATTCGAATGGTCCATAGGATGCTTG TGACAGGTCTTGGGCTGAAAGTTCAAGAAGCCAAAAATGGAAAAGAAGCTGTTGATCTTCATATCAATGGAGCTTCCTTTGACCTTATTTTAATGGATAT GGAAATGCCCATCATGAATGGTCCCGCGGCGACAAGGGAGCTTCGAGCAATGGGTGTGAAGAGCATCATTGTTGGTGTCACATCTCATACTTCTGAGTCT ATCCACAAAGATTTCATGGAAGCAGGCCTAAACCATTGTGTTGCGAAGCCAATGACTATAGCCAAGATTGCCCCCTTCCTTCCGAAATCCAACAACAACT AA
AA sequence Show only first row Show all	>Potri.019G024900.1 pacid=42774214 polypeptide=Potri.019G024900.1.p locus=Potri.019G024900 ID=Potri.019G024900.1.v4.1 annot-version=v4.1 MAGGEENNNGGKNSFSVLVVDDDTIIRMVHRMLVTGLGLKVQEAKNGKEAVDLHINGASFDLILMDMEMPIMNGPAATRELRAMGVKSIIVGVTSHTSES IHKDFMEAGLNHCVAKPMTIAKIAPFLPKSNNN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G26594		ARR24	response regulator 24 (.1)		Potri.019G024900 [exp]	0	1
AT5G28780			PIF1 helicase (.1)		Potri.011G042150 [exp]	1.41	1.0000
AT3G19280		FUCTA, FUCT1, A...	fucosyltransferase 11 (.1)		Potri.019G091200 [exp]	4.00	1.0000	FUCT3.1
					Potri.010G007833 [exp]	4.00	0.9352
					Potri.019G002628 [exp]	4.89	0.8964
AT2G35615			Eukaryotic aspartyl protease f...		Potri.003G105300 [exp]	5.09	0.8826
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Potri.004G036000 [exp]	6.00	0.9243
AT5G36930			Disease resistance protein (TI...		Potri.019G000657 [exp]	7.48	0.8172
AT5G42240		SCPL42	serine carboxypeptidase-like 4...		Potri.005G187700 [exp]	9.74	0.7715
AT3G22640		PAP85	cupin family protein (.1)		Potri.005G212333 [exp]	12.24	0.7237
AT1G17860			Kunitz family trypsin and prot...		Potri.010G007811 [exp]	13.03	0.7957

Compare expression of checked genes

Potri.019G024900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.