Plant FIBer expression Database

Potri.019G025000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26594 116 / 2e-34 ARR24 response regulator 24 (.1)
AT3G04280 111 / 2e-32 ARR22 response regulator 22 (.1.2.3)
AT2G47430 57 / 4e-10 CKI1 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
AT2G01830 55 / 1e-09 CRE1, AHK4, WOL1, WOL, ATCRE1 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3)
AT5G10720 55 / 1e-09 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1)
AT1G27320 50 / 8e-08 AHK3 histidine kinase 3 (.1)
AT5G35750 48 / 3e-07 AHK2 histidine kinase 2 (.1)
AT2G17820 43 / 2e-05 AHK1, ATHK1 histidine kinase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G024900
[exp]
223 / 1e-76 AT5G26594 121 / 2e-36 response regulator 24 (.1)
Potri.009G108000
[exp]
129 / 2e-39 AT5G26594 163 / 5e-53 response regulator 24 (.1)
Potri.003G177300
[exp]
126 / 4e-37 AT3G04280 96 / 8e-25 response regulator 22 (.1.2.3)
Potri.002G253000
[exp]
123 / 4e-37 AT5G26594 171 / 5e-56 response regulator 24 (.1)
Potri.003G177400
[exp]
124 / 5e-36 AT3G04280 99 / 9e-26 response regulator 22 (.1.2.3)
Potri.001G055500
[exp]
108 / 3e-29 AT5G26594 80 / 6e-18 response regulator 24 (.1)
Potri.003G172750
[exp]
100 / 7e-29 AT3G04280 80 / 1e-20 response regulator 22 (.1.2.3)
Potri.001G050800
[exp]
102 / 4e-28 AT5G26594 77 / 4e-18 response regulator 24 (.1)
Potri.003G172800
[exp]
105 / 2e-27 AT3G04280 76 / 2e-16 response regulator 22 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004775
[exp]
117 / 5e-35 AT5G26594 98 / 2e-27 response regulator 24 (.1)
Lus10005407
[exp]
99 / 1e-27 AT5G26594 135 / 2e-41 response regulator 24 (.1)
Lus10028021
[exp]
80 / 8e-20 AT5G26594 99 / 3e-27 response regulator 24 (.1)
Lus10031600
[exp]
66 / 3e-13 AT2G47430 624 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Lus10033746
[exp]
64 / 2e-12 AT2G47430 615 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Lus10035114
[exp]
60 / 3e-11 AT2G47430 132 / 2e-34 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Lus10031985
[exp]
59 / 7e-11 AT5G63890 752 / 0.0 HISTIDINE BIOSYNTHESIS 8, histidinol dehydrogenase (.1.2)
Lus10028992
[exp]
58 / 2e-10 AT2G01830 1337 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3)
Lus10003686
[exp]
56 / 7e-10 AT2G01830 1330 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3)
Lus10029849
[exp]
53 / 6e-09 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0304 CheY PF00072 Response_reg Response regulator receiver domain
Representative CDS sequence
>Potri.019G025000.1 pacid=42773782 polypeptide=Potri.019G025000.1.p locus=Potri.019G025000 ID=Potri.019G025000.1.v4.1 annot-version=v4.1
ATGGTTGGTGGAGAAGAGAACAATAATGAAGGCAAAAACAGCTTCATTGTGCTTGTTGTTGATGATGATACCGTCGTTCGAATGGTCCATAGGATGCTCG
TGACAAGTCTTGGGCTAAAAGTTCAAGAAGCCAAAAATGGAAAAGAAGCCGTTGATCTTCATATCAATGGAGCTTCCTTTGATCTTATTTTAATGGATAT
GGAAATGCCCATCATGAATGGTCCCACGGCGACAAGGGAGCTTCGAGCAATGGGTGTGAAGAGCACCATTATTGGTGTTACATCTTGTACTTTTGAGTCT
GTGCACAAAGATTTCATAGAAGCAGGCCTGGACCACTGTGTTGCGAAGCCATTGACTCTAGCCCAAATTGCCTCCTTCCTTCCGAAATCCAACAACAACT
AA
AA sequence
>Potri.019G025000.1 pacid=42773782 polypeptide=Potri.019G025000.1.p locus=Potri.019G025000 ID=Potri.019G025000.1.v4.1 annot-version=v4.1
MVGGEENNNEGKNSFIVLVVDDDTVVRMVHRMLVTSLGLKVQEAKNGKEAVDLHINGASFDLILMDMEMPIMNGPTATRELRAMGVKSTIIGVTSCTFES
VHKDFIEAGLDHCVAKPLTLAQIASFLPKSNNN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G26594 ARR24 response regulator 24 (.1) Potri.019G025000
[exp]
0 1

Potri.019G025000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.