Potri.019G026400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05950 289 / 1e-99 RmlC-like cupins superfamily protein (.1)
AT5G39150 285 / 2e-98 RmlC-like cupins superfamily protein (.1)
AT5G39120 285 / 2e-98 RmlC-like cupins superfamily protein (.1)
AT5G39180 285 / 4e-98 RmlC-like cupins superfamily protein (.1)
AT5G39190 285 / 4e-98 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
AT5G39130 285 / 4e-98 RmlC-like cupins superfamily protein (.1)
AT5G39160 284 / 6e-98 RmlC-like cupins superfamily protein (.1.2.3)
AT5G39110 284 / 6e-98 RmlC-like cupins superfamily protein (.1)
AT5G38960 269 / 7e-92 RmlC-like cupins superfamily protein (.1)
AT3G04200 265 / 2e-90 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G026500 426 / 4e-154 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026700 422 / 2e-152 AT3G05950 286 / 1e-98 RmlC-like cupins superfamily protein (.1)
Potri.019G025800 422 / 3e-152 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G025900 422 / 3e-152 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026000 422 / 3e-152 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026200 412 / 2e-148 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Potri.013G052000 312 / 7e-109 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Potri.013G052100 308 / 2e-107 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G064100 300 / 4e-104 AT5G39130 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006538 341 / 3e-120 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1)
Lus10000622 335 / 1e-117 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1)
Lus10006536 330 / 6e-116 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Lus10003114 327 / 2e-114 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10006543 327 / 2e-114 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10003116 326 / 2e-114 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10033767 324 / 2e-113 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
Lus10035186 261 / 7e-89 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
Lus10035185 261 / 7e-89 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10003267 261 / 1e-88 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF07883 Cupin_2 Cupin domain
Representative CDS sequence
>Potri.019G026400.6 pacid=42773711 polypeptide=Potri.019G026400.6.p locus=Potri.019G026400 ID=Potri.019G026400.6.v4.1 annot-version=v4.1
ATGAGAAGTGTTCATTTCCTACTAGCTTTTGTTCTCTTGACTCTGGCATCCTCAATTGCCTCTGCCTCTGACCCCAGTCCCCTTCAGGACTTCTGTGTAG
CCATCAATGATCCCAAGGCTGCTGTGTTTGTAAATGGGAAATTCTGTAAGGACCCGAAGATGGCGACAGCAAATGATTTCTCCTTTTCAGGACTGAACAT
TCCCAGAAACACAGGGAACCGAGTTGGATCAAATGTTACTCTCTTAAATGTAGATCAAATACCAGGGCTTAACACGCTTGGCATATCTTTGGCTCGCATT
GACTATGCACCAAATGGTGGCTTAAACCCACCCCATACTCACCCTCGTGCCACAGAGATTCTAGTAGTCGTCGAAGGCACACTCTATGTTGGATTTGTCA
CATCAAACCCAGAAAATCGTTTCATCAGCAAAGTCTTATACCCTGGAGATGTTTTTGTGTTTCCGTTTGGCCTCATTCACTTCCAACTCAATATTGCCAA
AACCCCTGCAGTTGTCTTTGCTGGTTTAAGCAGCCAAAATCCTGGTACTATTACAATAGCAAATGCAGTGTTCGGGTCCGATCCTCTCATCAATCCTGAT
GTTCTTGCCAAGGCCTTCCATTTGGACATCAAGATAGTGAACTATCTTCAGAAACTGTTTGGAGGAAACAGTGAGTGA
AA sequence
>Potri.019G026400.6 pacid=42773711 polypeptide=Potri.019G026400.6.p locus=Potri.019G026400 ID=Potri.019G026400.6.v4.1 annot-version=v4.1
MRSVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDFSFSGLNIPRNTGNRVGSNVTLLNVDQIPGLNTLGISLARI
DYAPNGGLNPPHTHPRATEILVVVEGTLYVGFVTSNPENRFISKVLYPGDVFVFPFGLIHFQLNIAKTPAVVFAGLSSQNPGTITIANAVFGSDPLINPD
VLAKAFHLDIKIVNYLQKLFGGNSE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05950 RmlC-like cupins superfamily p... Potri.019G026400 0 1
AT3G05950 RmlC-like cupins superfamily p... Potri.019G025900 4.79 0.9408
Potri.001G425600 5.09 0.9127
AT3G05950 RmlC-like cupins superfamily p... Potri.019G026700 7.07 0.9334
AT3G05950 RmlC-like cupins superfamily p... Potri.019G025800 10.95 0.9261
AT3G05950 RmlC-like cupins superfamily p... Potri.019G026500 12.16 0.9257
AT2G30210 LAC3 laccase 3 (.1) Potri.013G152700 14.07 0.9178
AT3G18170 Glycosyltransferase family 61 ... Potri.015G042300 16.06 0.9228
AT3G05950 RmlC-like cupins superfamily p... Potri.019G026000 16.94 0.9215
AT1G65870 Disease resistance-responsive ... Potri.016G060700 25.21 0.9129
AT4G35160 O-methyltransferase family pro... Potri.004G050500 26.26 0.9037 FOMT1,OOMT2.17

Potri.019G026400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.