Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05950 286 / 1e-98 RmlC-like cupins superfamily protein (.1) AT5G39150 283 / 2e-97 RmlC-like cupins superfamily protein (.1) AT5G39120 283 / 3e-97 RmlC-like cupins superfamily protein (.1) AT5G39190 282 / 3e-97 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39130 282 / 3e-97 RmlC-like cupins superfamily protein (.1) AT5G39180 282 / 4e-97 RmlC-like cupins superfamily protein (.1) AT5G39160 282 / 5e-97 RmlC-like cupins superfamily protein (.1.2.3) AT5G39110 281 / 1e-96 RmlC-like cupins superfamily protein (.1) AT5G38960 268 / 2e-91 RmlC-like cupins superfamily protein (.1) AT5G38940 265 / 2e-90 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G026400 [exp] 422 / 3e-152 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026500 [exp] 422 / 3e-152 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1) Potri.019G025800 [exp] 421 / 7e-152 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G025900 [exp] 421 / 7e-152 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026000 [exp] 421 / 7e-152 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026200 [exp] 408 / 7e-147 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Potri.013G052000 [exp] 308 / 4e-107 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G052100 [exp] 304 / 1e-105 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1) Potri.013G064100 [exp] 301 / 2e-104 AT5G39130 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006538 [exp] 337 / 2e-118 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1) Lus10000622 [exp] 330 / 5e-116 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1) Lus10006536 [exp] 326 / 4e-114 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Lus10003114 [exp] 325 / 4e-114 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006543 [exp] 325 / 4e-114 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10003116 [exp] 325 / 6e-114 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10033767 [exp] 323 / 4e-113 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Lus10003267 [exp] 265 / 3e-90 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1) Lus10035185 [exp] 257 / 4e-87 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10021980 [exp] 257 / 4e-87 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.019G026700.2 pacid=42773382 polypeptide=Potri.019G026700.2.p locus=Potri.019G026700 ID=Potri.019G026700.2.v4.1 annot-version=v4.1 ATGAGAAGTGTTCATTTCCTACTAGCTTTTGTTCTCTTGACTCTGGCATCCTCAATTGCCTCTGCCTCTGACCCCAGTCCCCTTCAGGACTTCTGTGTAG CCATCAATGATCCCAAGGCTGCTGTGTTTGTAAATGGGAAATTCTGTAAGGACCCGAAGATGGCGACAGCAAATGATTTCTCCTTTTCAGGACTCAACAT TCCCAGAGACACAGGGAACCGAGTTGGATCAAATGTTACTCTCTTAAATGTAGATCAAATACCAGGGCTTAACACGCTCGGCATATCTTTGGCTCGCATT GACTATGCACCAAATGGTGGCTTAAACCCACCCCATACTCACCCTCGTGCCACAGAGATTCTAGTAGTCGTCGAAGGCACACTCTATGTTGGATTTGTCA CATCAAACCCAGAAAATCGTTTCATCAGCAAAGTCTTATACCCTGGAGATGTTTTTGTGTTTCCGTTTGGCCTCATTCACTTCCAACTCAATATTGCCAA AACCCCTGCAGTTGTCTTTGCAGGTTTAAGCAGCCAAAATCCTGGTACTATTACAATAGCAAATGCAGTGTTCGGGTCCGATCCTCTCATCAATCCTGCT GTTCTTGCCAAGGCCTTCCATTTGGACATCAAGATAGTGAACTATCTTCAGAAACTGTTTGGAGGAAACAGTGAGTGA
AA sequence Show only first row Show all	>Potri.019G026700.2 pacid=42773382 polypeptide=Potri.019G026700.2.p locus=Potri.019G026700 ID=Potri.019G026700.2.v4.1 annot-version=v4.1 MRSVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDFSFSGLNIPRDTGNRVGSNVTLLNVDQIPGLNTLGISLARI DYAPNGGLNPPHTHPRATEILVVVEGTLYVGFVTSNPENRFISKVLYPGDVFVFPFGLIHFQLNIAKTPAVVFAGLSSQNPGTITIANAVFGSDPLINPA VLAKAFHLDIKIVNYLQKLFGGNSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026700 [exp]	0	1
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G025800 [exp]	1.41	0.9968
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G025900 [exp]	2.00	0.9944
AT2G22790			unknown protein		Potri.007G008900 [exp]	2.23	0.9707
AT1G65870			Disease resistance-responsive ...		Potri.016G060700 [exp]	2.44	0.9706
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026500 [exp]	2.44	0.9957
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026000 [exp]	3.00	0.9957
AT5G64700			nodulin MtN21 /EamA-like trans...		Potri.019G004100 [exp]	5.91	0.9654
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.004G215100 [exp]	6.00	0.9484
AT3G05220			Heavy metal transport/detoxifi...		Potri.007G021200 [exp]	6.32	0.9588
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026400 [exp]	7.07	0.9334

Compare expression of checked genes

Potri.019G026700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.