Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13440 127 / 2e-37 Calcium-binding EF-hand family protein (.1) AT1G66400 41 / 0.0002 CML23 calmodulin like 23 (.1) AT5G37770 40 / 0.0003 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT2G41100 40 / 0.0004 ATCAL4, TCH3 TOUCH 3, ARABIDOPSIS THALIANA CALMODULIN LIKE 4, Calcium-binding EF hand family protein (.1.2.3.4) AT2G15680 39 / 0.001 AtCML30 calmodulin-like 30, Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G026820 [exp] 282 / 3e-98 AT4G13440 122 / 7e-36 Calcium-binding EF-hand family protein (.1) Potri.019G029100 [exp] 248 / 1e-84 AT4G13440 106 / 1e-29 Calcium-binding EF-hand family protein (.1) Potri.019G027440 [exp] 245 / 9e-82 AT4G13440 112 / 2e-30 Calcium-binding EF-hand family protein (.1) Potri.019G028800 [exp] 229 / 8e-77 AT4G13440 106 / 3e-29 Calcium-binding EF-hand family protein (.1) Potri.019G026900 [exp] 224 / 4e-75 AT4G13440 105 / 1e-28 Calcium-binding EF-hand family protein (.1) Potri.019G027100 [exp] 224 / 4e-75 AT4G13440 105 / 1e-28 Calcium-binding EF-hand family protein (.1) Potri.019G026860 [exp] 221 / 7e-74 AT4G13440 112 / 7e-32 Calcium-binding EF-hand family protein (.1) Potri.019G027000 [exp] 221 / 8e-74 AT4G13440 105 / 5e-29 Calcium-binding EF-hand family protein (.1) Potri.019G026780 [exp] 220 / 2e-73 AT4G13440 112 / 1e-31 Calcium-binding EF-hand family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014050 [exp] 42 / 9e-05 AT2G15680 239 / 4e-81 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10009127 [exp] 42 / 0.0001 AT1G66400 147 / 2e-44 calmodulin like 23 (.1) Lus10019863 [exp] 42 / 0.0001 AT2G15680 233 / 9e-79 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10042370 [exp] 41 / 0.0004 AT3G57530 820 / 0.0 calcium-dependent protein kinase 32 (.1) Lus10000972 [exp] 40 / 0.0004 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10008631 [exp] 40 / 0.0006 AT1G74740 886 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Lus10042185 [exp] 40 / 0.0008 AT1G74740 777 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF00036 [poplar] [flax] EF-hand_1 EF hand CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand
Representative CDS sequence Show only first row Show all	>Potri.019G026740.1 pacid=42773386 polypeptide=Potri.019G026740.1.p locus=Potri.019G026740 ID=Potri.019G026740.1.v4.1 annot-version=v4.1 ATGGAGCAGACTCGCCGGGCTGCTGTAGCTTATTATGAACATCTGCCCGCTAAGACTAAGAAATTGGCCAGAAAAACTTTCAATGCCATGGATAAGAACG GAGACGGGCAAATTAGCCTACGTGAATACGTGGACTATCTCAAGAAAAACAAAGCCACAGATTTCACTCATCAGAGCTTGTTTACAGCGCTGGACAAGGA CGGCAATGGAAGCTTGGATTTTGAGGAAGCAATCGTCTTGTACTACATCATGCAGAGTGGAAGGGCTATAAGTTGCCAGTCTTGTAAGACGCTCTTGGCA GGAGCATACTTCAGTTGCTCTCAATGTTTCTTCAATGTTTCAGATAGCACCTATGAAATTTGTTGTGCTTGTTATGGTGGTAAAAATTACACACACCACG GTGATGCCATCTTCTGCGATAACTATACTTTACTACGTCAAAGCAGGAGCGTGATACAAGAGGCCCCCATAAAGAAGCGAAGAAAGGTGCTTAAATCCCA TAAAAAGAGACTGCTAGTTGCAGAGATAACTGTTGGTCTTGCAGGCATAACTGTTGGTGTTGCTGATCTTGCATCAAAATTTTACTGTAGCATTATGTGA
AA sequence Show only first row Show all	>Potri.019G026740.1 pacid=42773386 polypeptide=Potri.019G026740.1.p locus=Potri.019G026740 ID=Potri.019G026740.1.v4.1 annot-version=v4.1 MEQTRRAAVAYYEHLPAKTKKLARKTFNAMDKNGDGQISLREYVDYLKKNKATDFTHQSLFTALDKDGNGSLDFEEAIVLYYIMQSGRAISCQSCKTLLA GAYFSCSQCFFNVSDSTYEICCACYGGKNYTHHGDAIFCDNYTLLRQSRSVIQEAPIKKRRKVLKSHKKRLLVAEITVGLAGITVGVADLASKFYCSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13440			Calcium-binding EF-hand family...		Potri.019G026740 [exp]	0	1
AT4G13440			Calcium-binding EF-hand family...		Potri.019G026780 [exp]	2.64	0.9564
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117300 [exp]	3.31	0.9103
AT4G13440			Calcium-binding EF-hand family...		Potri.019G027440 [exp]	4.24	0.9225
AT1G47670			Transmembrane amino acid trans...		Potri.002G012900 [exp]	4.47	0.9209	PTRLHT10
AT2G44930			Plant protein of unknown funct...		Potri.012G035001 [exp]	6.63	0.9222
AT4G13440			Calcium-binding EF-hand family...		Potri.019G029000 [exp]	8.48	0.8992
AT5G18310			unknown protein		Potri.013G052600 [exp]	8.66	0.8396
AT2G44930			Plant protein of unknown funct...		Potri.012G035100 [exp]	13.96	0.9059
AT2G37900			Major facilitator superfamily ...		Potri.017G145532 [exp]	14.49	0.8953
AT4G31980			unknown protein		Potri.003G206801 [exp]	15.42	0.9177

Compare expression of checked genes

Potri.019G026740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.