Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49230 123 / 1e-36 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) AT3G06760 120 / 1e-35 Drought-responsive family protein (.1.2) AT3G05700 108 / 1e-30 Drought-responsive family protein (.1) AT5G26990 105 / 8e-30 Drought-responsive family protein (.1) AT1G56280 83 / 5e-21 ATDI19 drought-induced 19 (.1.2) AT1G02750 82 / 2e-20 Drought-responsive family protein (.1.2) AT4G02200 80 / 9e-20 Drought-responsive family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G213400 [exp] 174 / 1e-56 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.010G000800 [exp] 158 / 2e-50 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.013G011200 [exp] 114 / 4e-33 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1) Potri.005G020900 [exp] 108 / 9e-31 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1) Potri.002G200500 [exp] 82 / 2e-20 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1) Potri.014G125500 [exp] 78 / 5e-19 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1) Potri.011G057200 [exp] 76 / 3e-18 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2) Potri.012G086500 [exp] 54 / 6e-10 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037819 [exp] 124 / 9e-37 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10031467 [exp] 104 / 5e-29 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1) Lus10013420 [exp] 82 / 2e-20 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2) Lus10002441 [exp] 79 / 2e-20 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1) Lus10001462 [exp] 81 / 4e-20 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1) Lus10017097 [exp] 76 / 3e-18 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10037717 [exp] 73 / 2e-16 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1) Lus10015412 [exp] 66 / 5e-14 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1) Lus10010305 [exp] 64 / 1e-13 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2) Lus10015214 [exp] 60 / 3e-12 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [poplar] [flax] C2H2-zf PF05605 [poplar] [flax] zf-Di19 Drought induced 19 protein (Di19), zinc-binding
Representative CDS sequence Show only first row Show all	>Potri.019G027300.1 pacid=42773044 polypeptide=Potri.019G027300.1.p locus=Potri.019G027300 ID=Potri.019G027300.1.v4.1 annot-version=v4.1 ATGGTGTTTGAAAGCTGCTTTTTTTTTGGATTTTTTTGTTGGTTTGTGGTGCTAGATCTGTATGATGAGACTAAAACAGAAGAGGATTTGAAAGCAGAGT ATTTGTGTCCATTTTGCGGCGAGGATTTTGATGTTGTTGGTCTCTTTTGCCACATCCATGAAGAGCATCCTGCTGAAGCCAAGAATGGGGTATGTCCAGT TTGTGCTAAAAGGGTGGGGATGAACATTGTTACTCACATTACTGGGCAGCATGGGAACTTCTTTAATGTGCAGCGTAAGAGGAGACTGCAGAAGGGGGGG AGCTAA
AA sequence Show only first row Show all	>Potri.019G027300.1 pacid=42773044 polypeptide=Potri.019G027300.1.p locus=Potri.019G027300 ID=Potri.019G027300.1.v4.1 annot-version=v4.1 MVFESCFFFGFFCWFVVLDLYDETKTEEDLKAEYLCPFCGEDFDVVGLFCHIHEEHPAEAKNGVCPVCAKRVGMNIVTHITGQHGNFFNVQRKRRLQKGG S

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G49230		HRB1	HYPERSENSITIVE TO RED AND BLUE...		Potri.019G027300 [exp]	0	1
AT1G54390		ING2	INHIBITOR OF GROWTH 2, PHD fin...		Potri.019G033800 [exp]	6.92	0.6616
AT4G02425			unknown protein		Potri.014G129500 [exp]	13.82	0.6747
AT4G28990			RNA-binding protein-related (....		Potri.006G160500 [exp]	17.23	0.5847
AT4G33690			unknown protein		Potri.009G082200 [exp]	31.01	0.5532
AT4G11790			Pleckstrin homology (PH) domai...		Potri.003G120900 [exp]	37.70	0.5910
AT1G08370		DCP1, ATDCP1	decapping 1 (.1)		Potri.006G208600 [exp]	44.39	0.5215
AT1G60650		AtRZ-1b	AtRZ-1b, RNA-binding (RRM/RBD/...		Potri.008G033000 [exp]	69.08	0.5350
AT4G18905			Transducin/WD40 repeat-like su...		Potri.007G019601 [exp]	83.33	0.5472
AT5G57580			Calmodulin-binding protein (.1...		Potri.005G020200 [exp]	84.85	0.5369	CBP60.7
AT2G40410			Staphylococcal nuclease homolo...		Potri.010G182500 [exp]	98.23	0.5331

Compare expression of checked genes

Potri.019G027300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.