Potri.019G028500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00140 147 / 3e-48 ATCG00140.1, ATPH ATP synthase subunit C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G138490 148 / 2e-48 ATCG00140 115 / 2e-35 ATP synthase subunit C family protein (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00137 ATP-synt_C ATP synthase subunit C
Representative CDS sequence
>Potri.019G028500.1 pacid=42773281 polypeptide=Potri.019G028500.1.p locus=Potri.019G028500 ID=Potri.019G028500.1.v4.1 annot-version=v4.1
ATGAATCCATTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTTGGGCTTGCTTCTATTGGACCTAGGGTTGGTCAAGGTACTGCTGCGGGCC
AAGCTGTAGAAGGTATCGCGAGACAACCCGAGGCAGAGGGGAAAATACGAGGTACTTTATTGCTTAGTCTGGCTTTTATGGAAGCTTTAACAATTTATGG
ACTGGTTGTAGCATTAACACTTTTATTTGCGAATCCTTTTGTTTAA
AA sequence
>Potri.019G028500.1 pacid=42773281 polypeptide=Potri.019G028500.1.p locus=Potri.019G028500 ID=Potri.019G028500.1.v4.1 annot-version=v4.1
MNPLISAASVIAAGLAVGLASIGPRVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALTLLFANPFV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00140 ATCG00140.1, AT... ATP synthase subunit C family ... Potri.019G028500 0 1
ATCG00140 ATCG00140.1, AT... ATP synthase subunit C family ... Potri.013G138490 1.00 0.9845
ATCG00120 ATCG00120.1, AT... ATP synthase subunit alpha (.1... Potri.013G138000 10.95 0.8881
ATCG00130 ATCG00130.1, AT... ATPase, F0 complex, subunit B/... Potri.013G137900 32.55 0.8993
AT3G54500 unknown protein Potri.001G025100 36.05 0.6682
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G074750 40.60 0.8672
ATCG01100 ATCG01100.1, ND... NADH dehydrogenase family prot... Potri.013G074800 47.32 0.8685
ATCG00710 ATCG00710.1, PS... photosystem II reaction center... Potri.019G028200 47.59 0.8696
ATCG00540 ATCG00540.1, PE... photosynthetic electron transf... Potri.016G094201 52.30 0.7818
ATCG00210 ATCG00210.1, YC... electron transporter, transfer... Potri.013G142332 55.82 0.8617
ATCG00730 ATCG00730.1, PE... photosynthetic electron transf... Potri.011G074600 60.61 0.8555

Potri.019G028500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.