Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SYP111.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08560 432 / 2e-153 KN, ATSYP111, SYP111 KNOLLE, syntaxin of plants 111 (.1) AT1G61290 283 / 1e-94 ATSYP124, SYP124 syntaxin of plants 124 (.1) AT3G11820 270 / 4e-89 PEN1, AT-SYR1, ATSYR1, ATSYP121, SYP121 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) AT4G03330 266 / 2e-88 ATSYP123, SYP123 syntaxin of plants 123 (.1) AT1G11250 265 / 9e-88 ATSYP125, SYP125 syntaxin of plants 125 (.1) AT3G52400 249 / 6e-81 ATSYP122, SYP122 syntaxin of plants 122 (.1) AT3G03800 222 / 7e-71 ATSYP131, SYP131 syntaxin of plants 131 (.1) AT2G18260 211 / 2e-66 ATSYP112, SYP112 syntaxin of plants 112 (.1) AT5G08080 208 / 2e-65 ATSYP132, SYP132 syntaxin of plants 132 (.1.2.3) AT5G46860 49 / 1e-06 SGR3, ATVAM3, ATSYP22, VAM3 SHOOT GRAVITROPISM 3, ARABIDOPSIS THALIANA VACUOLAR MORPHOLOGY 3, ARABIDOPSIS THALIANA SYNTAXIN OF PLANTS 22, Syntaxin/t-SNARE family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G053200 [exp] 545 / 0 AT1G08560 430 / 8e-153 KNOLLE, syntaxin of plants 111 (.1) Potri.011G043700 [exp] 287 / 1e-96 AT1G61290 456 / 3e-163 syntaxin of plants 124 (.1) Potri.004G035400 [exp] 286 / 5e-96 AT1G61290 490 / 8e-177 syntaxin of plants 124 (.1) Potri.006G202200 [exp] 277 / 2e-92 AT3G11820 412 / 3e-145 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Potri.016G068600 [exp] 275 / 9e-92 AT3G11820 421 / 5e-149 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Potri.007G023100 [exp] 246 / 2e-80 AT2G18260 352 / 3e-122 syntaxin of plants 112 (.1) Potri.009G117900 [exp] 241 / 9e-79 AT2G18260 298 / 4e-101 syntaxin of plants 112 (.1) Potri.005G121300 [exp] 223 / 2e-71 AT2G18260 356 / 6e-124 syntaxin of plants 112 (.1) Potri.019G036700 [exp] 221 / 9e-71 AT3G03800 391 / 1e-137 syntaxin of plants 131 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042527 [exp] 481 / 1e-172 AT1G08560 391 / 2e-137 KNOLLE, syntaxin of plants 111 (.1) Lus10021988 [exp] 479 / 4e-172 AT1G08560 388 / 2e-136 KNOLLE, syntaxin of plants 111 (.1) Lus10018441 [exp] 286 / 4e-96 AT1G61290 491 / 4e-177 syntaxin of plants 124 (.1) Lus10011244 [exp] 283 / 9e-95 AT1G61290 487 / 2e-175 syntaxin of plants 124 (.1) Lus10006735 [exp] 282 / 2e-94 AT1G61290 491 / 3e-177 syntaxin of plants 124 (.1) Lus10021263 [exp] 280 / 5e-93 AT3G11820 436 / 3e-154 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10020089 [exp] 266 / 2e-87 AT1G61290 467 / 2e-166 syntaxin of plants 124 (.1) Lus10016173 [exp] 265 / 2e-87 AT3G11820 432 / 2e-152 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10013589 [exp] 264 / 3e-87 AT3G11820 437 / 2e-155 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10029373 [exp] 258 / 9e-85 AT3G11820 441 / 4e-157 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [poplar] [flax] SNARE-fusion PF00804 [poplar] [flax] Syntaxin Syntaxin CL0445 [poplar] [flax] PF05739 [poplar] [flax] SNARE SNARE domain
Representative CDS sequence Show only first row Show all	>Potri.019G030800.2 pacid=42774239 polypeptide=Potri.019G030800.2.p locus=Potri.019G030800 ID=Potri.019G030800.2.v4.1 annot-version=v4.1 ATGAATGACCTAATGACCAAATCGTTTATGAGCTATGTGGACCTAAAGAAAGAGGCCATGAAAGATCTTGAAGCAGGCCCTGACCATGATTTAGAAATGG CAAATGCATCAAACACCATGGACAGCAACCTTGGTCTGTTCCTTGAAGAAGCTGAGGATGTAAAGAAAAAAATGCGATCGATCCGTGAGATTCTTGACCA GTTGCAAGAAGCAAATGAAGAAAGCAAGTCCTTACACAAACATGAGGCCTTAAAATCGATACGAAACAAAATCAATGCAGATATTGTTAAAGGCCTGAAA AAGGCCAGAAGTATTAAAACCCAGCTTGAAGAAATGGATCGTGCCAATGCTGCTAATAGGCGCCTTTCAGGGTACAAGGAAGGAACTCCGATTTATAGAA CAAGGGTTGCTGTTACTAATTGCTTGCGCAAGAAATTGAAGGAGCTGATGATGGATTTTCAAGCTTTAAGGCAAAAAATGATGATTGAGTATAAAGATAC TGTTGGTAGGAGGTATTTCACTGTTACCGGAGAGTACCCAGATGAGGAAGTCATTGATAAGATCATCTCTGATGGTAATGGGGGTGAGGAGTTCTTGAAA CGTGCAATCCAGGAGCATGGGAAAGGGAAGGTGTTGGAGACTGTGGTGGAGATACAGGACAGGTATGATGCTGCCAAAGAGATTGAGAAGAGCTTGTTGG AGCTGCACCAGGTGTTTTTGGACATGGCAGTGATGGTGGAGGCACAAGGGGAGCAGATGGATGATATTGAGCACCATGTGTTGAATGCTAGTCACTATGT GAAGGATGGTACCAAAGAGCTCAAGAGTGCTAAAGATCACCAGAAGAGCAGCAGGAAATGGATGTGTATCGGTATCATTCTCCTTTTGATAATCATTCTT GTGATTGTTATACCTATCGTTACTAGCTTTAGCTACTCTTGA
AA sequence Show only first row Show all	>Potri.019G030800.2 pacid=42774239 polypeptide=Potri.019G030800.2.p locus=Potri.019G030800 ID=Potri.019G030800.2.v4.1 annot-version=v4.1 MNDLMTKSFMSYVDLKKEAMKDLEAGPDHDLEMANASNTMDSNLGLFLEEAEDVKKKMRSIREILDQLQEANEESKSLHKHEALKSIRNKINADIVKGLK KARSIKTQLEEMDRANAANRRLSGYKEGTPIYRTRVAVTNCLRKKLKELMMDFQALRQKMMIEYKDTVGRRYFTVTGEYPDEEVIDKIISDGNGGEEFLK RAIQEHGKGKVLETVVEIQDRYDAAKEIEKSLLELHQVFLDMAVMVEAQGEQMDDIEHHVLNASHYVKDGTKELKSAKDHQKSSRKWMCIGIILLLIIIL VIVIPIVTSFSYS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G08560		KN, ATSYP111, S...	KNOLLE, syntaxin of plants 11...		Potri.019G030800 [exp]	0	1	SYP111.2
AT5G15080			Protein kinase superfamily pro...		Potri.004G129000 [exp]	4.12	0.8982
AT5G14390			alpha/beta-Hydrolases superfam...		Potri.001G340000 [exp]	7.07	0.8586
AT5G67130			PLC-like phosphodiesterases su...		Potri.005G140100 [exp]	9.16	0.8515
AT2G24290			Protein of unknown function (D...		Potri.013G026900 [exp]	9.32	0.8787
AT5G66840			SAP domain-containing protein ...		Potri.003G069700 [exp]	10.19	0.8821
AT1G51740		ATSYP81, SYP81,...	ORTHOLOG OF YEAST UFE1 \(UNKNO...		Potri.008G063100 [exp]	14.24	0.8615	SYP81.1
AT3G49250		IDN1, DMS3	INVOLVED IN DE NOVO 1, defecti...		Potri.002G172000 [exp]	17.97	0.8535
AT1G68060		ATMAP70-1	microtubule-associated protein...		Potri.010G106100 [exp]	19.74	0.8744
AT1G50240		FU	FUSED, Protein kinase family p...		Potri.019G052500 [exp]	24.24	0.8701
AT3G19210		ATRAD54, CHR25	homolog of RAD54 (.1.2)		Potri.004G141500 [exp]	24.37	0.8462

Compare expression of checked genes

Potri.019G030800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.