Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SIP1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04090 235 / 3e-78 SIP1A, SIP1;1 small and basic intrinsic protein 1A (.1) AT5G18290 226 / 1e-74 SIP1B, SIP1;2 SMALL AND BASIC INTRINSIC PROTEIN 1B, Aquaporin-like superfamily protein (.1.2) AT3G56950 107 / 2e-28 SIP2;1, SIP2 small and basic intrinsic protein 2;1 (.1.2) AT1G73190 57 / 2e-09 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT1G17810 52 / 8e-08 BETA-TIP beta-tonoplast intrinsic protein (.1) AT2G45960 49 / 8e-07 PIP1;2, ATHH2, TMP-A, PIP1B TRANSMEMBRANE PROTEIN A, NAMED PLASMA MEMBRANE INTRINSIC PROTEIN 1;2, plasma membrane intrinsic protein 1B (.1.2.3) AT2G25810 49 / 1e-06 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT3G61430 48 / 2e-06 ATPIP1, PIP1;1, PIP1A PLASMA MEMBRANE INTRINSIC PROTEIN 1;1, ARABIDOPSIS THALIANA PLASMA MEMBRANE INTRINSIC PROTEIN 1, plasma membrane intrinsic protein 1A (.1.2) AT2G16850 47 / 5e-06 PIP3B, PIP2;8 PLASMA MEMBRANE INTRINSIC PROTEIN 3B, plasma membrane intrinsic protein 2;8 (.1) AT4G01470 47 / 5e-06 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G053400 [exp] 367 / 6e-130 AT3G04090 224 / 6e-74 small and basic intrinsic protein 1A (.1) Potri.014G154400 [exp] 225 / 5e-74 AT5G18290 183 / 2e-57 SMALL AND BASIC INTRINSIC PROTEIN 1B, Aquaporin-like superfamily protein (.1.2) Potri.002G227500 [exp] 221 / 2e-72 AT5G18290 165 / 2e-50 SMALL AND BASIC INTRINSIC PROTEIN 1B, Aquaporin-like superfamily protein (.1.2) Potri.006G027200 [exp] 103 / 6e-27 AT3G56950 264 / 1e-89 small and basic intrinsic protein 2;1 (.1.2) Potri.016G024900 [exp] 100 / 1e-25 AT3G56950 303 / 1e-104 small and basic intrinsic protein 2;1 (.1.2) Potri.017G154800 [exp] 53 / 4e-08 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1) Potri.001G235300 [exp] 52 / 6e-08 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1) Potri.009G027200 [exp] 52 / 8e-08 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1) Potri.006G239700 [exp] 49 / 7e-07 AT2G25810 355 / 5e-125 tonoplast intrinsic protein 4;1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021989 [exp] 221 / 6e-66 AT5G65560 498 / 2e-157 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035281 [exp] 189 / 6e-60 AT3G04090 176 / 9e-55 small and basic intrinsic protein 1A (.1) Lus10030046 [exp] 181 / 8e-57 AT3G04090 172 / 2e-53 small and basic intrinsic protein 1A (.1) Lus10035395 [exp] 97 / 5e-23 AT5G05070 463 / 1e-158 DHHC-type zinc finger family protein (.1) Lus10030997 [exp] 96 / 2e-22 AT3G56930 332 / 1e-107 DHHC-type zinc finger family protein (.1.2) Lus10038989 [exp] 91 / 1e-21 AT3G56950 248 / 5e-83 small and basic intrinsic protein 2;1 (.1.2) Lus10027275 [exp] 90 / 1e-21 AT3G56950 249 / 2e-83 small and basic intrinsic protein 2;1 (.1.2) Lus10005885 [exp] 52 / 8e-08 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10040863 [exp] 50 / 2e-07 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1) Lus10031158 [exp] 47 / 8e-07 AT3G47440 155 / 2e-48 tonoplast intrinsic protein 5;1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [poplar] [flax] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Potri.019G030900.1 pacid=42773106 polypeptide=Potri.019G030900.1.p locus=Potri.019G030900 ID=Potri.019G030900.1.v4.1 annot-version=v4.1 ATGGGGGCAATAAAGGCAGCATCTGGGGATGCGGTGTTAACTTTCATGTGGGTGTTTGTGTCTTCCATGTTTGGTTTGTTCACAAACCTGATAGTTACTG CCCTTGGTCTTCAAACCCTGGTCTGGGCTCCTCTGGTCATTACTACTTTTATTGTCTTCACCTTTGTTTTCTTGTTTAACTTGATTGGTGAAGCCTTGGG TGGTGCCAGTTTTAACCCAACTGGTACTGCTTCTTTCTATGCTGCTGGGGTTGGTGGAGACACTCTCTTCTCCATGGCCCTCAGATTCCCTGCTCAGGCA GCAGGGGCTGTGGGAGGTGCGTTGGCTATCATGGAGGTGATGCCAGTTCAGTATAAGCACATGCTTGGGGGGCCTACTTTGCAGGTGGACTTGCATACTG GAGGCCTTGCTGAGGGGGTTTTGACCTTCTTAATGAGTTTTGCTGTTCTTGTAATTATCCTTAAAGGCCCTCGTAACCCTCTGGTGCAGACATTGTTTCT TGCCATTGCGACCATAACATTGGTGGTTGCAGGTTCTACTTACACCGGTCCTTCCATGAATCCTGCCAATGCCTTTGGGTGGGCATATGTAAGAAAATGG CACAACACATGGGAGCAGCTCTATGTTTACTGGATCTGCCCCTTCATCGGAGCGATATTGGCCTCCTGGGTCTTCCGTGCTGTCTTCCCCCCACCAGCAC CCAAACAAAAGAAAGCCTAA
AA sequence Show only first row Show all	>Potri.019G030900.1 pacid=42773106 polypeptide=Potri.019G030900.1.p locus=Potri.019G030900 ID=Potri.019G030900.1.v4.1 annot-version=v4.1 MGAIKAASGDAVLTFMWVFVSSMFGLFTNLIVTALGLQTLVWAPLVITTFIVFTFVFLFNLIGEALGGASFNPTGTASFYAAGVGGDTLFSMALRFPAQA AGAVGGALAIMEVMPVQYKHMLGGPTLQVDLHTGGLAEGVLTFLMSFAVLVIILKGPRNPLVQTLFLAIATITLVVAGSTYTGPSMNPANAFGWAYVRKW HNTWEQLYVYWICPFIGAILASWVFRAVFPPPAPKQKKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04090		SIP1A, SIP1;1	small and basic intrinsic prot...		Potri.019G030900 [exp]	0	1	Pt-SIP1.2
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Potri.009G159800 [exp]	4.58	0.9115
AT5G42800		M318, TT3, DFR	dihydroflavonol 4-reductase (....		Potri.001G093300 [exp]	19.33	0.8910
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Potri.001G389200 [exp]	26.26	0.8876
AT4G20030			RNA-binding (RRM/RBD/RNP motif...		Potri.003G074900 [exp]	34.56	0.8789
AT1G31300			TRAM, LAG1 and CLN8 (TLC) lipi...		Potri.005G206000 [exp]	36.98	0.8522
AT2G18245			alpha/beta-Hydrolases superfam...		Potri.007G023000 [exp]	37.41	0.7997
AT1G53920		GLIP5	GDSL-motif lipase 5 (.1)		Potri.018G063901 [exp]	50.31	0.8714
AT4G04780		MED21	mediator 21 (.1)		Potri.004G017100 [exp]	57.98	0.8497
AT5G38060			unknown protein		Potri.017G122500 [exp]	63.05	0.8699
					Potri.001G278504 [exp]	82.51	0.8482

Compare expression of checked genes

Potri.019G030900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.