Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04070 332 / 1e-112 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G69490 256 / 4e-84 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G61110 253 / 5e-82 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G15510 248 / 8e-80 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G52880 232 / 7e-74 NAC ATNAM, NAM, ANAC018, NARS2 NAC-REGULATED SEED MORPHOLOGY 2, Arabidopsis NAC domain containing protein 18, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G27410 231 / 1e-73 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G52890 228 / 2e-72 NAC ANAC019 NAC domain containing protein 19 (.1) AT3G15500 228 / 3e-72 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G01720 225 / 1e-71 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 221 / 2e-70 NAC ANAC032 NAC domain containing protein 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G054000 [exp] 530 / 0 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2) Potri.001G404400 [exp] 263 / 3e-85 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G046700 [exp] 261 / 9e-85 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.004G038000 [exp] 260 / 2e-84 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G123500 [exp] 259 / 4e-84 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.008G089000 [exp] 253 / 2e-82 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.010G166200 [exp] 239 / 4e-77 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.004G049500 [exp] 241 / 5e-77 AT1G61110 232 / 4e-74 NAC domain containing protein 25 (.1) Potri.006G129400 [exp] 239 / 3e-76 AT1G61110 247 / 3e-80 NAC domain containing protein 25 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006547 [exp] 332 / 2e-112 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10003269 [exp] 331 / 7e-112 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10021992 [exp] 330 / 3e-111 AT3G04070 295 / 1e-97 NAC domain containing protein 47 (.1.2) Lus10042531 [exp] 329 / 6e-111 AT3G04070 303 / 4e-101 NAC domain containing protein 47 (.1.2) Lus10011215 [exp] 262 / 6e-85 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10018469 [exp] 261 / 1e-84 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10043095 [exp] 259 / 9e-84 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10032657 [exp] 259 / 1e-83 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10037156 [exp] 250 / 2e-81 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10030446 [exp] 249 / 3e-81 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.019G031400.1 pacid=42774644 polypeptide=Potri.019G031400.1.p locus=Potri.019G031400 ID=Potri.019G031400.1.v4.1 annot-version=v4.1 ATGAAGAACCAACAATCAAGCTTGCCACCAGGGTTTAGGTTCCACCCCACAGACGAGGAGCTCATCCTCCATTACCTTAGGAAGAAGGTAGCATCCACAC CCTTTCCTGTGTCTATCATTGCAGATGTTGATATCTACAAGTTTGATCCATGGGACTTGCCAGCCAAAGCTGCCTTGGGAGAGAAAGAGTGGTACTTTTT CAGTCCCAGAGATCGTAAGTACCCCAATGGAGCTAGGCCTAACAGAGCTGCTGCCTCTGGATATTGGAAGGCGACGGGAACAGACAAGGTCATAATGGCG TCAACAATCACGCCTGGAGGTGTAATTATACAAGGACAAGAGAACGTTGGTGTAAAAAAGGCTCTTGTCTTCTACAAGGGAAAGCCTCCGAAGGGAGTCA AGACTGACTGGATTATGCATGAGTATCGCCTAGCAGATACCTCCAGCTACAGCTACAACAAACCCATGAAGCCAAGAGATTCATCCATGAGGTTGGATGA CTGGGTTCTTTGCCGGATTTACAAGAAAGCCCATGCTTTAACTTCATGTGCGAGAGCAGAAATGTCCAGTGAACATGAGCAGGAAGAAGAAGAGGAACAT TTTGTCCCAGAAAACCCTTTACCAAGCTTGAAAGGTCCCATAAGCAACAAGAGCGCGCTCATGTCCCAGAAATCTTGCTCCTTCTCCAACTTATTAGATG CCATGGACTATTCCCTATTGAGCAGTTTACTAGCAGATACCCAGTTCAACCCAACAGGGTTTGAGTCAAATCCTGCACTGAATAGCACTGCTTCCCAACT GGACCAGCCTCCTTTCTTCAGTAACAGCAATATTGCAGGCGGCGGGGGCGGGGGCTGCTTTCTTCAAAAGTTACCTCAGTTGAGCGCCTCAGCGCCCAAC AACGTGGACAACAAACTCAAGCGCCAGCTTTCACACATTGATGAGGACATGCTGCATCCATCAAAGAAGTTCATGAACTCTTGCAGTTTCACTAACACCA ACAACATTAGTACCCAAACTGATAATGGTCAATACAACTTCCTAAGCCAGCCATTCTTGAACCAGCAATTCCTTCTGAGCCCACATCTTCAATTTCAAGG TTAA
AA sequence Show only first row Show all	>Potri.019G031400.1 pacid=42774644 polypeptide=Potri.019G031400.1.p locus=Potri.019G031400 ID=Potri.019G031400.1.v4.1 annot-version=v4.1 MKNQQSSLPPGFRFHPTDEELILHYLRKKVASTPFPVSIIADVDIYKFDPWDLPAKAALGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKVIMA STITPGGVIIQGQENVGVKKALVFYKGKPPKGVKTDWIMHEYRLADTSSYSYNKPMKPRDSSMRLDDWVLCRIYKKAHALTSCARAEMSSEHEQEEEEEH FVPENPLPSLKGPISNKSALMSQKSCSFSNLLDAMDYSLLSSLLADTQFNPTGFESNPALNSTASQLDQPPFFSNSNIAGGGGGGCFLQKLPQLSASAPN NVDNKLKRQLSHIDEDMLHPSKKFMNSCSFTNTNNISTQTDNGQYNFLSQPFLNQQFLLSPHLQFQG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.019G031400 [exp]	0	1
AT5G13330	AP2_ERF	RAP2.6L	related to AP2 6l (.1)		Potri.003G162500 [exp]	2.44	0.9082
AT3G19580	C2H2ZnF	AZF2	zinc-finger protein 2 (.1.2)		Potri.009G089400 [exp]	4.00	0.9100
AT1G75388		CPuORF5	conserved peptide upstream ope...		Potri.005G119400 [exp]	4.24	0.8732
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Potri.007G084800 [exp]	7.93	0.8693	IFS1.47,CYP736A4v1
AT5G46080			Protein kinase superfamily pro...		Potri.011G058300 [exp]	13.41	0.8885
AT5G48100		LAC15, TT10, AT...	TRANSPARENT TESTA 10, LACCASE-...		Potri.005G200500 [exp]	14.56	0.8868
AT4G08570			Heavy metal transport/detoxifi...		Potri.005G167000 [exp]	14.89	0.8429
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Potri.019G003700 [exp]	16.58	0.8761
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Potri.009G032800 [exp]	17.32	0.8689
AT3G63010		ATGID1B, GID1B	GA INSENSITIVE DWARF1B, alpha/...		Potri.002G213100 [exp]	19.41	0.8652

Compare expression of checked genes

Potri.019G031400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.