Potri.019G036220 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G221051 68 / 3e-16 ND /
Potri.019G045466 62 / 2e-14 ND /
Potri.010G007402 0 / 1 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G036220.1 pacid=42774226 polypeptide=Potri.019G036220.1.p locus=Potri.019G036220 ID=Potri.019G036220.1.v4.1 annot-version=v4.1
ATGGTCTGTTGCGTTCTCTGCTTCACCGTGTCCTCTGCTTCCGTTCGCTTTTATAGCCAGAGGACGCAGGCGTTTTTGGTAAGCCGGCGTGCATCACAGT
GGCCAGAGATTTCAGCCGCAATACGCGCCCCTCTTGATTTGAAAATGGCTCCATTATCGCTGCTAACGTCTCCTTCCTTTTTTATCAAGATTCACAGCTG
TTGA
AA sequence
>Potri.019G036220.1 pacid=42774226 polypeptide=Potri.019G036220.1.p locus=Potri.019G036220 ID=Potri.019G036220.1.v4.1 annot-version=v4.1
MVCCVLCFTVSSASVRFYSQRTQAFLVSRRASQWPEISAAIRAPLDLKMAPLSLLTSPSFFIKIHSC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G036220 0 1
AT1G09380 nodulin MtN21 /EamA-like trans... Potri.005G006600 8.12 0.9761
Potri.011G026450 11.66 0.9747
AT2G25660 EMB2410 embryo defective 2410 (.1) Potri.006G246401 14.21 0.9323
Potri.014G065951 14.89 0.9744
AT4G27670 HSP21 heat shock protein 21 (.1) Potri.015G005801 19.49 0.9740
AT2G25730 unknown protein Potri.018G035601 24.18 0.9721
AT5G09380 RNA polymerase III RPC4 (.1) Potri.005G126802 28.93 0.7871
AT3G19090 RNA-binding protein (.1) Potri.004G144700 29.52 0.8439
AT4G16265 NRPE9B, NRPD9B,... RNA polymerases M/15 Kd subuni... Potri.010G142500 32.44 0.9707
AT3G54070 Ankyrin repeat family protein ... Potri.011G016400 32.49 0.9664

Potri.019G036220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.