Potri.019G036450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G036450.1 pacid=42773744 polypeptide=Potri.019G036450.1.p locus=Potri.019G036450 ID=Potri.019G036450.1.v4.1 annot-version=v4.1
ATGACCAGAGTTTTAATTTGCTGTTTTGGCAAAGGTTTTAACATGAGTTTGCAGAGGGTTTCAGGGCTCCAAAAGACCGAGAAAAAAGGCTGGTGTTGCA
GGTGGTATGTCAAGGGAGAGGTCGCTGTCTTCATTGTCTGTGGTTCGATGAGAGTAGAAGAGCATTAA
AA sequence
>Potri.019G036450.1 pacid=42773744 polypeptide=Potri.019G036450.1.p locus=Potri.019G036450 ID=Potri.019G036450.1.v4.1 annot-version=v4.1
MTRVLICCFGKGFNMSLQRVSGLQKTEKKGWCCRWYVKGEVAVFIVCGSMRVEEH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G036450 0 1
AT3G13330 PA200 proteasome activating protein ... Potri.001G470600 2.23 0.8080
AT3G59030 ATTT12, TT12 TRANSPARENT TESTA 12, A. THALI... Potri.002G055100 2.44 0.8567
Potri.006G189401 3.00 0.8445
AT3G59030 ATTT12, TT12 TRANSPARENT TESTA 12, A. THALI... Potri.005G207600 3.16 0.8660
AT5G64740 PRC1, IXR2, E11... PROCUSTE 1, ISOXABEN RESISTANT... Potri.005G027600 7.74 0.8072 CESA2.3
AT1G22640 MYB AtMYB3 ARABIDOPSIS THALIANA MYB DOMA... Potri.015G041100 15.74 0.8173 Pt-MYB.36
AT3G50810 Uncharacterised protein family... Potri.009G110200 16.09 0.7297
AT2G19170 SLP3 subtilisin-like serine proteas... Potri.001G092700 16.15 0.6755
AT3G21420 LBO1 LATERAL BRANCHING OXIDOREDUCTA... Potri.010G023600 21.90 0.7725
AT2G36290 alpha/beta-Hydrolases superfam... Potri.008G021200 23.06 0.8053

Potri.019G036450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.