Potri.019G038352 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs

No hit found

Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G038352.1 pacid=42773660 polypeptide=Potri.019G038352.1.p locus=Potri.019G038352 ID=Potri.019G038352.1.v4.1 annot-version=v4.1
ATGGCAGGAATCATGCACAAGATTGAGGAGACCCTCCACATTGGAGGCAAAAAAGAAGAGCAAAAGAGTGGGAAATCTGGTGAGGAGCACAAGAGTGGGA
AATCTGGTGAGCACAAAGGTGAACACAAGGGGGAGTACCGTGGTGAGCACAAGGAAGGATTTGTTGACAAGATCCATGGTGATGGCCATGGCGAAGGAGA
GAAAAAGAAGAAGGAGAAGAAGGAGAAGAAGAAGAAGGAGAAGAAGCATGGTCATGATGGCCATAGCAGCAGTGACAGCGACAGTGATTAA
AA sequence
>Potri.019G038352.1 pacid=42773660 polypeptide=Potri.019G038352.1.p locus=Potri.019G038352 ID=Potri.019G038352.1.v4.1 annot-version=v4.1
MAGIMHKIEETLHIGGKKEEQKSGKSGEEHKSGKSGEHKGEHKGEYRGEHKEGFVDKIHGDGHGEGEKKKKEKKEKKKKEKKHGHDGHSSSDSDSD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G038352 0 1
AT2G35680 Phosphotyrosine protein phosph... Potri.001G154700 9.16 0.7648
Potri.013G066640 12.44 0.7420
Potri.019G009900 18.49 0.7655
Potri.003G220866 23.87 0.7282
AT2G01710 Chaperone DnaJ-domain superfam... Potri.002G105500 27.74 0.6549
AT1G21760 ATFBP7 F-box protein 7 (.1) Potri.005G178600 30.98 0.6798
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Potri.011G132400 32.74 0.7074
AT2G06005 FIP1 FRIGIDA interacting protein 1 ... Potri.018G056500 34.24 0.7054
Potri.015G054350 34.29 0.6920
AT2G26850 F-box family protein (.1) Potri.006G040000 35.49 0.6817

Potri.019G038352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.