Potri.019G038550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03773 197 / 6e-66 HSP20-like chaperones superfamily protein (.1.2)
AT4G02450 97 / 2e-25 HSP20-like chaperones superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G062600 220 / 1e-74 AT3G03773 191 / 3e-63 HSP20-like chaperones superfamily protein (.1.2)
Potri.002G061500 103 / 2e-28 AT4G02450 123 / 4e-35 HSP20-like chaperones superfamily protein (.1.2)
Potri.005G199700 102 / 4e-28 AT4G02450 127 / 9e-37 HSP20-like chaperones superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010669 196 / 6e-65 AT3G03773 223 / 6e-76 HSP20-like chaperones superfamily protein (.1.2)
Lus10002623 163 / 2e-52 AT3G03773 165 / 2e-53 HSP20-like chaperones superfamily protein (.1.2)
Lus10020270 167 / 1e-49 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10024119 110 / 5e-32 AT3G03773 121 / 2e-36 HSP20-like chaperones superfamily protein (.1.2)
Lus10000340 113 / 2e-31 AT4G02450 120 / 5e-34 HSP20-like chaperones superfamily protein (.1.2)
Lus10026136 112 / 8e-31 AT4G02450 122 / 1e-34 HSP20-like chaperones superfamily protein (.1.2)
Lus10008680 113 / 3e-30 AT5G04940 216 / 8e-64 SU(VAR)3-9 homolog 1 (.1), SU(VAR)3-9 homolog 1 (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF04969 CS CS domain
Representative CDS sequence
>Potri.019G038550.1 pacid=42774521 polypeptide=Potri.019G038550.1.p locus=Potri.019G038550 ID=Potri.019G038550.1.v4.1 annot-version=v4.1
ATGTGCAGTAGGCACCCAGAGGTTCTGTGGGCTCAGAGATCAGACAAGGTTTACTTGACGATTGCATTACCTGATGCTAAAGACGTATCAGTGAAATGTG
AAGGTGGAGGATTATTTAGTTTCTCTGCTGTTGGGGTTCAAGGCGAATCCTTTGATTTCAGTTTGGAACTCTTTGGAAACATTGTTCCTGAGGGTTCTAA
AACTAAGGTTGGGTTGAGGAACATTATATGCTCAATCCAGAAAGAAGAGAAAGTCTGGTGGAAAAGGCTGTTAAAATCTGAAGGGAAGCCTGCTCCTTAC
ATTAAGGTGGATTGGAACAAGTGGTTTGATGAGGATGATGAAAAGTCAGCTTCTGATGCCTCTGATGACAATAATGCTGGGTATGAAAAAGATGATGGGA
GCAGTGATGATGAAGGAATGCTTTATCTTCCTGATCTTGAGAAGGCAAGGGGAACTTGA
AA sequence
>Potri.019G038550.1 pacid=42774521 polypeptide=Potri.019G038550.1.p locus=Potri.019G038550 ID=Potri.019G038550.1.v4.1 annot-version=v4.1
MCSRHPEVLWAQRSDKVYLTIALPDAKDVSVKCEGGGLFSFSAVGVQGESFDFSLELFGNIVPEGSKTKVGLRNIICSIQKEEKVWWKRLLKSEGKPAPY
IKVDWNKWFDEDDEKSASDASDDNNAGYEKDDGSSDDEGMLYLPDLEKARGT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G03773 HSP20-like chaperones superfam... Potri.019G038550 0 1
AT5G27430 Signal peptidase subunit (.1) Potri.018G058000 7.74 0.7465 SPP.2
AT3G10950 Zinc-binding ribosomal protein... Potri.002G140100 13.49 0.7576
AT5G27820 Ribosomal L18p/L5e family prot... Potri.007G100900 17.54 0.7100
AT4G03150 unknown protein Potri.014G135400 29.98 0.6623
AT5G28060 Ribosomal protein S24e family ... Potri.013G036100 30.09 0.7227 Pt-RPS24.2
AT4G18100 Ribosomal protein L32e (.1) Potri.014G191000 32.61 0.7434
AT4G27090 Ribosomal protein L14 (.1) Potri.005G227300 33.39 0.7304
AT4G35490 MRPL11 mitochondrial ribosomal protei... Potri.007G058600 44.72 0.6826
Potri.009G050900 44.89 0.6700
AT3G05560 Ribosomal L22e protein family ... Potri.005G024400 47.11 0.7053

Potri.019G038550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.